Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   GRT15_RS11800 Genome accession   NZ_CP047157
Coordinates   2468407..2468844 (-) Length   145 a.a.
NCBI ID   WP_015388002.1    Uniprot ID   -
Organism   Bacillus velezensis strain FJAT-45028     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2463407..2473844
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GRT15_RS11750 (GRT15_11750) sinI 2463792..2463965 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  GRT15_RS11755 (GRT15_11755) sinR 2463999..2464334 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  GRT15_RS11760 (GRT15_11760) tasA 2464382..2465167 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  GRT15_RS11765 (GRT15_11765) sipW 2465231..2465815 (-) 585 WP_012117977.1 signal peptidase I SipW -
  GRT15_RS11770 (GRT15_11770) tapA 2465787..2466458 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  GRT15_RS11775 (GRT15_11775) - 2466717..2467046 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  GRT15_RS11780 (GRT15_11780) - 2467086..2467265 (-) 180 WP_003153093.1 YqzE family protein -
  GRT15_RS11785 (GRT15_11785) comGG 2467322..2467699 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  GRT15_RS11790 (GRT15_11790) comGF 2467700..2468200 (-) 501 WP_235570156.1 competence type IV pilus minor pilin ComGF -
  GRT15_RS11795 (GRT15_11795) comGE 2468109..2468423 (-) 315 WP_057080485.1 competence type IV pilus minor pilin ComGE Machinery gene
  GRT15_RS11800 (GRT15_11800) comGD 2468407..2468844 (-) 438 WP_015388002.1 competence type IV pilus minor pilin ComGD Machinery gene
  GRT15_RS11805 (GRT15_11805) comGC 2468834..2469142 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  GRT15_RS11810 (GRT15_11810) comGB 2469147..2470184 (-) 1038 WP_063174751.1 competence type IV pilus assembly protein ComGB Machinery gene
  GRT15_RS11815 (GRT15_11815) comGA 2470171..2471241 (-) 1071 WP_044053465.1 competence type IV pilus ATPase ComGA Machinery gene
  GRT15_RS11820 (GRT15_11820) - 2471433..2472383 (-) 951 WP_014305415.1 magnesium transporter CorA family protein -
  GRT15_RS11825 (GRT15_11825) - 2472529..2473830 (+) 1302 WP_014305416.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16328.84 Da        Isoelectric Point: 10.3354

>NTDB_id=411151 GRT15_RS11800 WP_015388002.1 2468407..2468844(-) (comGD) [Bacillus velezensis strain FJAT-45028]
MNNNRRTENGFTLLESLVVLSLTSVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSSGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIRLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=411151 GRT15_RS11800 WP_015388002.1 2468407..2468844(-) (comGD) [Bacillus velezensis strain FJAT-45028]
TTGAACAATAACAGGCGGACAGAAAACGGGTTTACCCTTCTTGAAAGCCTGGTTGTGTTAAGCCTGACGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTTCAAAAAGATA
TTCAGCTTGCGCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAAGCGGTAGGATTGTCGAGCGTTCTTTTGATTCACTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCGATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

54.795

100

0.552


Multiple sequence alignment