Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | GRT15_RS11750 | Genome accession | NZ_CP047157 |
| Coordinates | 2463792..2463965 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain FJAT-45028 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2458792..2468965
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GRT15_RS11735 (GRT15_11735) | gcvT | 2459609..2460709 (-) | 1101 | WP_095315606.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| GRT15_RS11740 (GRT15_11740) | - | 2461133..2462803 (+) | 1671 | WP_003153107.1 | DEAD/DEAH box helicase | - |
| GRT15_RS11745 (GRT15_11745) | - | 2462821..2463615 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| GRT15_RS11750 (GRT15_11750) | sinI | 2463792..2463965 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| GRT15_RS11755 (GRT15_11755) | sinR | 2463999..2464334 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| GRT15_RS11760 (GRT15_11760) | tasA | 2464382..2465167 (-) | 786 | WP_015388008.1 | biofilm matrix protein TasA | - |
| GRT15_RS11765 (GRT15_11765) | sipW | 2465231..2465815 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| GRT15_RS11770 (GRT15_11770) | tapA | 2465787..2466458 (-) | 672 | WP_003153099.1 | amyloid fiber anchoring/assembly protein TapA | - |
| GRT15_RS11775 (GRT15_11775) | - | 2466717..2467046 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| GRT15_RS11780 (GRT15_11780) | - | 2467086..2467265 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| GRT15_RS11785 (GRT15_11785) | comGG | 2467322..2467699 (-) | 378 | WP_014305410.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| GRT15_RS11790 (GRT15_11790) | comGF | 2467700..2468200 (-) | 501 | WP_235570156.1 | competence type IV pilus minor pilin ComGF | - |
| GRT15_RS11795 (GRT15_11795) | comGE | 2468109..2468423 (-) | 315 | WP_057080485.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| GRT15_RS11800 (GRT15_11800) | comGD | 2468407..2468844 (-) | 438 | WP_015388002.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=411147 GRT15_RS11750 WP_003153105.1 2463792..2463965(+) (sinI) [Bacillus velezensis strain FJAT-45028]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=411147 GRT15_RS11750 WP_003153105.1 2463792..2463965(+) (sinI) [Bacillus velezensis strain FJAT-45028]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |