Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   GE573_RS11800 Genome accession   NZ_CP047119
Coordinates   2304439..2304558 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain AK-0     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 2299439..2309558
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GE573_RS11785 (GE573_02347) - 2301051..2301734 (+) 684 WP_007410267.1 response regulator transcription factor -
  GE573_RS11790 (GE573_02348) - 2301721..2303154 (+) 1434 WP_165913860.1 HAMP domain-containing sensor histidine kinase -
  GE573_RS11795 (GE573_02349) rapC 2303307..2304455 (+) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  GE573_RS11800 (GE573_02350) phrC 2304439..2304558 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  GE573_RS11805 - 2304707..2304817 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  GE573_RS11810 (GE573_02351) - 2304897..2306261 (-) 1365 WP_190664058.1 aspartate kinase -
  GE573_RS11815 (GE573_02352) ceuB 2306675..2307628 (+) 954 WP_059366593.1 ABC transporter permease Machinery gene
  GE573_RS11820 (GE573_02353) - 2307618..2308565 (+) 948 WP_007410274.1 iron chelate uptake ABC transporter family permease subunit -
  GE573_RS11825 (GE573_02354) - 2308559..2309317 (+) 759 WP_190664059.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=410687 GE573_RS11800 WP_003156334.1 2304439..2304558(+) (phrC) [Bacillus velezensis strain AK-0]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=410687 GE573_RS11800 WP_003156334.1 2304439..2304558(+) (phrC) [Bacillus velezensis strain AK-0]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment