Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   GE573_RS02000 Genome accession   NZ_CP047119
Coordinates   391643..392080 (-) Length   145 a.a.
NCBI ID   WP_015240210.1    Uniprot ID   -
Organism   Bacillus velezensis strain AK-0     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 386643..397080
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GE573_RS01950 (GE573_00388) sinI 387027..387200 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  GE573_RS01955 (GE573_00389) sinR 387234..387569 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  GE573_RS01960 (GE573_00390) tasA 387617..388402 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  GE573_RS01965 (GE573_00391) sipW 388467..389051 (-) 585 WP_015240205.1 signal peptidase I SipW -
  GE573_RS01970 (GE573_00392) tapA 389023..389694 (-) 672 WP_063094776.1 amyloid fiber anchoring/assembly protein TapA -
  GE573_RS01975 (GE573_00393) - 389953..390282 (+) 330 WP_190664424.1 DUF3889 domain-containing protein -
  GE573_RS01980 (GE573_00394) - 390322..390501 (-) 180 WP_003153093.1 YqzE family protein -
  GE573_RS01985 (GE573_00395) comGG 390558..390935 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  GE573_RS01990 (GE573_00396) comGF 390936..391436 (-) 501 WP_263322854.1 competence type IV pilus minor pilin ComGF -
  GE573_RS01995 (GE573_00397) comGE 391345..391659 (-) 315 WP_080130386.1 competence type IV pilus minor pilin ComGE Machinery gene
  GE573_RS02000 (GE573_00398) comGD 391643..392080 (-) 438 WP_015240210.1 competence type IV pilus minor pilin ComGD Machinery gene
  GE573_RS02005 (GE573_00399) comGC 392070..392336 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  GE573_RS02010 (GE573_00400) comGB 392383..393420 (-) 1038 WP_080130385.1 competence type IV pilus assembly protein ComGB Machinery gene
  GE573_RS02015 (GE573_00401) comGA 393407..394477 (-) 1071 WP_007408320.1 competence type IV pilus ATPase ComGA Machinery gene
  GE573_RS02020 (GE573_00402) - 394670..395620 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -
  GE573_RS02025 (GE573_00403) - 395766..397067 (+) 1302 WP_063094766.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16272.75 Da        Isoelectric Point: 10.2186

>NTDB_id=410645 GE573_RS02000 WP_015240210.1 391643..392080(-) (comGD) [Bacillus velezensis strain AK-0]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGKILERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=410645 GE573_RS02000 WP_015240210.1 391643..392080(-) (comGD) [Bacillus velezensis strain AK-0]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAGCAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAAGATTCTCGAGCGTTCCTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.849

100

0.572


Multiple sequence alignment