Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | GE573_RS01950 | Genome accession | NZ_CP047119 |
| Coordinates | 387027..387200 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain AK-0 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 382027..392200
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GE573_RS01935 (GE573_00385) | gcvT | 382840..383940 (-) | 1101 | WP_190664423.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| GE573_RS01940 (GE573_00386) | - | 384364..386034 (+) | 1671 | WP_072589380.1 | DEAD/DEAH box helicase | - |
| GE573_RS01945 (GE573_00387) | - | 386056..386850 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| GE573_RS01950 (GE573_00388) | sinI | 387027..387200 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| GE573_RS01955 (GE573_00389) | sinR | 387234..387569 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| GE573_RS01960 (GE573_00390) | tasA | 387617..388402 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| GE573_RS01965 (GE573_00391) | sipW | 388467..389051 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| GE573_RS01970 (GE573_00392) | tapA | 389023..389694 (-) | 672 | WP_063094776.1 | amyloid fiber anchoring/assembly protein TapA | - |
| GE573_RS01975 (GE573_00393) | - | 389953..390282 (+) | 330 | WP_190664424.1 | DUF3889 domain-containing protein | - |
| GE573_RS01980 (GE573_00394) | - | 390322..390501 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| GE573_RS01985 (GE573_00395) | comGG | 390558..390935 (-) | 378 | WP_012117980.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| GE573_RS01990 (GE573_00396) | comGF | 390936..391436 (-) | 501 | WP_263322854.1 | competence type IV pilus minor pilin ComGF | - |
| GE573_RS01995 (GE573_00397) | comGE | 391345..391659 (-) | 315 | WP_080130386.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| GE573_RS02000 (GE573_00398) | comGD | 391643..392080 (-) | 438 | WP_015240210.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=410641 GE573_RS01950 WP_003153105.1 387027..387200(+) (sinI) [Bacillus velezensis strain AK-0]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=410641 GE573_RS01950 WP_003153105.1 387027..387200(+) (sinI) [Bacillus velezensis strain AK-0]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |