Detailed information
Bioinformatically predicted
Overview
| Name | comC/comC1 | Type | Regulator |
| Locus tag | GO596_RS09440 | Genome accession | NZ_CP046628 |
| Coordinates | 792286..792432 (-) | Length | 48 a.a. |
| NCBI ID | WP_169741101.1 | Uniprot ID | - |
| Organism | Streptococcus equinus strain CNU 77-23 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 787286..797432
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GO596_RS03945 (GO596_03945) | - | 787346..787525 (+) | 180 | WP_039691373.1 | hypothetical protein | - |
| GO596_RS03950 (GO596_03950) | - | 787572..787877 (-) | 306 | Protein_704 | cysteine peptidase family C39 domain-containing protein | - |
| GO596_RS09535 | - | 788112..788222 (+) | 111 | WP_232516872.1 | ComC/BlpC family leader-containing pheromone/bacteriocin | - |
| GO596_RS03955 (GO596_03955) | - | 788189..788350 (+) | 162 | WP_232516873.1 | hypothetical protein | - |
| GO596_RS03960 (GO596_03960) | - | 788416..788727 (+) | 312 | WP_061408660.1 | hypothetical protein | - |
| GO596_RS03965 (GO596_03965) | - | 788917..789528 (+) | 612 | WP_157339237.1 | thioredoxin family protein | - |
| GO596_RS03970 (GO596_03970) | comE/comE1 | 790219..790950 (+) | 732 | WP_157339238.1 | response regulator transcription factor | Regulator |
| GO596_RS03975 (GO596_03975) | - | 790955..792265 (+) | 1311 | WP_157339239.1 | sensor histidine kinase | - |
| GO596_RS09440 | comC/comC1 | 792286..792432 (-) | 147 | WP_169741101.1 | hypothetical protein | Regulator |
| GO596_RS03980 (GO596_03980) | - | 792620..792916 (+) | 297 | WP_157339240.1 | DUF3884 family protein | - |
| GO596_RS03985 (GO596_03985) | - | 792936..793241 (+) | 306 | WP_024344359.1 | bacteriocin immunity protein | - |
| GO596_RS03990 (GO596_03990) | - | 793273..793566 (+) | 294 | WP_157339241.1 | bacteriocin immunity protein | - |
| GO596_RS03995 (GO596_03995) | comD/comD3 | 793914..795104 (+) | 1191 | WP_232516874.1 | sensor histidine kinase | Regulator |
| GO596_RS04000 (GO596_04000) | comD/comD3 | 795094..796467 (+) | 1374 | WP_157339242.1 | GHKL domain-containing protein | Regulator |
Sequence
Protein
Download Length: 48 a.a. Molecular weight: 5476.29 Da Isoelectric Point: 8.7393
>NTDB_id=406263 GO596_RS09440 WP_169741101.1 792286..792432(-) (comC/comC1) [Streptococcus equinus strain CNU 77-23]
MNEWKLSELNSVKNLTEADLEKTVGGDTTLLTGVVNWFKIFNKPKKHT
MNEWKLSELNSVKNLTEADLEKTVGGDTTLLTGVVNWFKIFNKPKKHT
Nucleotide
Download Length: 147 bp
>NTDB_id=406263 GO596_RS09440 WP_169741101.1 792286..792432(-) (comC/comC1) [Streptococcus equinus strain CNU 77-23]
ATGAATGAATGGAAATTATCAGAATTAAACTCTGTTAAGAATTTAACAGAAGCTGATTTGGAGAAGACCGTTGGAGGAGA
TACCACTCTACTCACTGGTGTTGTTAATTGGTTTAAAATTTTTAATAAGCCTAAAAAACATACGTAA
ATGAATGAATGGAAATTATCAGAATTAAACTCTGTTAAGAATTTAACAGAAGCTGATTTGGAGAAGACCGTTGGAGGAGA
TACCACTCTACTCACTGGTGTTGTTAATTGGTTTAAAATTTTTAATAAGCCTAAAAAACATACGTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC1 | Streptococcus equinus JB1 |
71.429 |
100 |
0.729 |