Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   GO005_RS12470 Genome accession   NZ_CP046592
Coordinates   2439821..2440204 (-) Length   127 a.a.
NCBI ID   WP_032722118.1    Uniprot ID   -
Organism   Bacillus subtilis strain TR21     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2434821..2445204
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GO005_RS12430 (GO005_12410) sinI 2435754..2435927 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  GO005_RS12435 (GO005_12415) sinR 2435961..2436296 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  GO005_RS12440 (GO005_12420) tasA 2436389..2437174 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  GO005_RS12445 (GO005_12425) sipW 2437238..2437810 (-) 573 WP_072692741.1 signal peptidase I SipW -
  GO005_RS12450 (GO005_12430) tapA 2437794..2438555 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  GO005_RS12455 (GO005_12435) yqzG 2438827..2439153 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  GO005_RS12460 (GO005_12440) spoIITA 2439195..2439374 (-) 180 WP_029726723.1 YqzE family protein -
  GO005_RS12465 (GO005_12445) comGG 2439446..2439820 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  GO005_RS12470 (GO005_12450) comGF 2439821..2440204 (-) 384 WP_032722118.1 ComG operon protein ComGF Machinery gene
  GO005_RS12475 (GO005_12455) comGE 2440230..2440577 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  GO005_RS12480 (GO005_12460) comGD 2440561..2440992 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  GO005_RS12485 (GO005_12465) comGC 2440982..2441278 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  GO005_RS12490 (GO005_12470) comGB 2441292..2442329 (-) 1038 WP_029317912.1 comG operon protein ComGB Machinery gene
  GO005_RS12495 (GO005_12475) comGA 2442316..2443386 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  GO005_RS12500 (GO005_12480) - 2443599..2443796 (-) 198 WP_014480259.1 CBS domain-containing protein -
  GO005_RS12505 (GO005_12485) corA 2443798..2444751 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14375.50 Da        Isoelectric Point: 5.8940

>NTDB_id=405879 GO005_RS12470 WP_032722118.1 2439821..2440204(-) (comGF) [Bacillus subtilis strain TR21]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENCVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=405879 GO005_RS12470 WP_032722118.1 2439821..2440204(-) (comGF) [Bacillus subtilis strain TR21]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATTGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

97.638

100

0.976


Multiple sequence alignment