Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   GO005_RS12430 Genome accession   NZ_CP046592
Coordinates   2435754..2435927 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain TR21     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2430754..2440927
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GO005_RS12415 (GO005_12395) gcvT 2431553..2432641 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  GO005_RS12420 (GO005_12400) hepAA 2433083..2434756 (+) 1674 WP_029726726.1 SNF2-related protein -
  GO005_RS12425 (GO005_12405) yqhG 2434777..2435571 (+) 795 WP_015714249.1 YqhG family protein -
  GO005_RS12430 (GO005_12410) sinI 2435754..2435927 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  GO005_RS12435 (GO005_12415) sinR 2435961..2436296 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  GO005_RS12440 (GO005_12420) tasA 2436389..2437174 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  GO005_RS12445 (GO005_12425) sipW 2437238..2437810 (-) 573 WP_072692741.1 signal peptidase I SipW -
  GO005_RS12450 (GO005_12430) tapA 2437794..2438555 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  GO005_RS12455 (GO005_12435) yqzG 2438827..2439153 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  GO005_RS12460 (GO005_12440) spoIITA 2439195..2439374 (-) 180 WP_029726723.1 YqzE family protein -
  GO005_RS12465 (GO005_12445) comGG 2439446..2439820 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  GO005_RS12470 (GO005_12450) comGF 2439821..2440204 (-) 384 WP_032722118.1 ComG operon protein ComGF Machinery gene
  GO005_RS12475 (GO005_12455) comGE 2440230..2440577 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=405876 GO005_RS12430 WP_003230187.1 2435754..2435927(+) (sinI) [Bacillus subtilis strain TR21]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=405876 GO005_RS12430 WP_003230187.1 2435754..2435927(+) (sinI) [Bacillus subtilis strain TR21]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment