Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   GKC27_RS15660 Genome accession   NZ_CP046130
Coordinates   2995111..2995251 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus pumilus strain DSM 27     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2990111..3000251
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GKC27_RS15635 (GKC27_15465) - 2990446..2990835 (-) 390 WP_003213775.1 hotdog fold thioesterase -
  GKC27_RS15640 (GKC27_15470) comA 2990859..2991500 (-) 642 WP_003213500.1 response regulator transcription factor Regulator
  GKC27_RS15645 (GKC27_15475) comP 2991581..2993872 (-) 2292 WP_003213749.1 ATP-binding protein Regulator
  GKC27_RS15650 (GKC27_15480) comX 2993879..2994058 (-) 180 WP_034620107.1 competence pheromone ComX -
  GKC27_RS15655 (GKC27_15485) - 2994036..2994959 (-) 924 WP_003212977.1 polyprenyl synthetase family protein -
  GKC27_RS15660 (GKC27_15490) degQ 2995111..2995251 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  GKC27_RS15665 (GKC27_15495) - 2995757..2996110 (+) 354 WP_034620108.1 hypothetical protein -
  GKC27_RS15670 (GKC27_15500) - 2996141..2997367 (-) 1227 WP_003212852.1 HDOD domain-containing protein -
  GKC27_RS15675 (GKC27_15505) - 2997507..2998976 (-) 1470 WP_003212630.1 nicotinate phosphoribosyltransferase -
  GKC27_RS15680 (GKC27_15510) - 2998994..2999545 (-) 552 WP_003213138.1 isochorismatase family cysteine hydrolase -
  GKC27_RS15685 (GKC27_15515) - 2999606..3000013 (-) 408 WP_003212896.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=401460 GKC27_RS15660 WP_003213123.1 2995111..2995251(-) (degQ) [Bacillus pumilus strain DSM 27]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=401460 GKC27_RS15660 WP_003213123.1 2995111..2995251(-) (degQ) [Bacillus pumilus strain DSM 27]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment