Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   GJS30_RS16000 Genome accession   NZ_CP045993
Coordinates   3268171..3268311 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain LABIM22     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3263171..3273311
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GJS30_RS15980 (GJS30_15925) - 3263468..3263851 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  GJS30_RS15985 (GJS30_15930) comA 3263873..3264517 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  GJS30_RS15990 (GJS30_15935) comP 3264598..3266901 (-) 2304 WP_021495364.1 histidine kinase Regulator
  GJS30_RS15995 (GJS30_15945) comQ 3267027..3267986 (-) 960 WP_223204411.1 class 1 isoprenoid biosynthesis enzyme Regulator
  GJS30_RS16000 (GJS30_15950) degQ 3268171..3268311 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  GJS30_RS16005 (GJS30_15955) - 3268777..3269118 (+) 342 WP_007613435.1 hypothetical protein -
  GJS30_RS16010 (GJS30_15960) - 3269125..3270348 (-) 1224 WP_007613436.1 EAL and HDOD domain-containing protein -
  GJS30_RS16015 (GJS30_15965) - 3270478..3271944 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  GJS30_RS16020 (GJS30_15970) - 3271962..3272513 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  GJS30_RS16025 (GJS30_15975) - 3272610..3273008 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=400084 GJS30_RS16000 WP_003152043.1 3268171..3268311(-) (degQ) [Bacillus velezensis strain LABIM22]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=400084 GJS30_RS16000 WP_003152043.1 3268171..3268311(-) (degQ) [Bacillus velezensis strain LABIM22]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment