Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   GJS30_RS13040 Genome accession   NZ_CP045993
Coordinates   2706355..2706732 (-) Length   125 a.a.
NCBI ID   WP_025649851.1    Uniprot ID   -
Organism   Bacillus velezensis strain LABIM22     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2701355..2711732
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GJS30_RS13000 (GJS30_12950) - 2701852..2702646 (+) 795 WP_014418368.1 YqhG family protein -
  GJS30_RS13005 (GJS30_12955) sinI 2702823..2702996 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  GJS30_RS13010 (GJS30_12960) sinR 2703030..2703365 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  GJS30_RS13015 (GJS30_12965) tasA 2703413..2704198 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  GJS30_RS13020 (GJS30_12970) sipW 2704263..2704847 (-) 585 WP_012117977.1 signal peptidase I SipW -
  GJS30_RS13025 (GJS30_12975) tapA 2704819..2705490 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  GJS30_RS13030 (GJS30_12980) - 2705749..2706078 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  GJS30_RS13035 (GJS30_12985) - 2706119..2706298 (-) 180 WP_003153093.1 YqzE family protein -
  GJS30_RS13040 (GJS30_12990) comGG 2706355..2706732 (-) 378 WP_025649851.1 competence type IV pilus minor pilin ComGG Machinery gene
  GJS30_RS13045 (GJS30_12995) comGF 2706733..2707128 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  GJS30_RS13050 (GJS30_13000) comGE 2707142..2707456 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  GJS30_RS13055 (GJS30_13005) comGD 2707440..2707877 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  GJS30_RS13060 (GJS30_13010) comGC 2707867..2708175 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  GJS30_RS13065 (GJS30_13015) comGB 2708180..2709217 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  GJS30_RS13070 (GJS30_13020) comGA 2709204..2710274 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  GJS30_RS13075 (GJS30_13025) - 2710467..2711417 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14151.04 Da        Isoelectric Point: 9.6404

>NTDB_id=400063 GJS30_RS13040 WP_025649851.1 2706355..2706732(-) (comGG) [Bacillus velezensis strain LABIM22]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKGQTGTQRFPYGTVS
FYITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=400063 GJS30_RS13040 WP_025649851.1 2706355..2706732(-) (comGG) [Bacillus velezensis strain LABIM22]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGGCCAAACTGGTACACAGCGTTTTCCGTACGGCACCGTTTCT
TTTTACATCACCGGGAGTGATCGAAGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

52.419

99.2

0.52

Multiple sequence alignment