Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | GJS30_RS13005 | Genome accession | NZ_CP045993 |
| Coordinates | 2702823..2702996 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis strain LABIM22 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2697823..2707996
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GJS30_RS12990 (GJS30_12940) | gcvT | 2698636..2699736 (-) | 1101 | WP_179156203.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| GJS30_RS12995 (GJS30_12945) | - | 2700160..2701830 (+) | 1671 | WP_021494309.1 | DEAD/DEAH box helicase | - |
| GJS30_RS13000 (GJS30_12950) | - | 2701852..2702646 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| GJS30_RS13005 (GJS30_12955) | sinI | 2702823..2702996 (+) | 174 | WP_014418369.1 | anti-repressor SinI | Regulator |
| GJS30_RS13010 (GJS30_12960) | sinR | 2703030..2703365 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| GJS30_RS13015 (GJS30_12965) | tasA | 2703413..2704198 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| GJS30_RS13020 (GJS30_12970) | sipW | 2704263..2704847 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| GJS30_RS13025 (GJS30_12975) | tapA | 2704819..2705490 (-) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| GJS30_RS13030 (GJS30_12980) | - | 2705749..2706078 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| GJS30_RS13035 (GJS30_12985) | - | 2706119..2706298 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| GJS30_RS13040 (GJS30_12990) | comGG | 2706355..2706732 (-) | 378 | WP_025649851.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| GJS30_RS13045 (GJS30_12995) | comGF | 2706733..2707128 (-) | 396 | WP_025649850.1 | competence type IV pilus minor pilin ComGF | - |
| GJS30_RS13050 (GJS30_13000) | comGE | 2707142..2707456 (-) | 315 | WP_017418140.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| GJS30_RS13055 (GJS30_13005) | comGD | 2707440..2707877 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=400061 GJS30_RS13005 WP_014418369.1 2702823..2702996(+) (sinI) [Bacillus velezensis strain LABIM22]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=400061 GJS30_RS13005 WP_014418369.1 2702823..2702996(+) (sinI) [Bacillus velezensis strain LABIM22]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |