Detailed information
Overview
| Name | cipB | Type | Regulator |
| Locus tag | SPNOXC_RS02675 | Genome accession | NC_017592 |
| Coordinates | 496335..496484 (+) | Length | 49 a.a. |
| NCBI ID | WP_001808912.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae OXC141 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 491335..501484
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPNOXC_RS02650 (SPNOXC04890) | blpC | 491646..491801 (-) | 156 | WP_000358813.1 | quorum-sensing system pheromone BlpC | - |
| SPNOXC_RS02655 (SPNOXC04900) | - | 491858..493219 (-) | 1362 | WP_001069092.1 | bacteriocin secretion accessory protein | - |
| SPNOXC_RS13400 | comA/nlmT | 493230..493718 (-) | 489 | WP_307774349.1 | ATP-binding cassette domain-containing protein | Regulator |
| SPNOXC_RS13405 | comA/nlmT | 493702..494142 (-) | 441 | WP_001808911.1 | ATP-binding cassette domain-containing protein | Regulator |
| SPNOXC_RS13410 | comA/nlmT | 494132..494857 (-) | 726 | WP_167750760.1 | ABC transporter transmembrane domain-containing protein | Regulator |
| SPNOXC_RS13415 (SPNOXC04920) | comA/nlmT | 494802..495389 (-) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| SPNOXC_RS02670 (SPNOXC04930) | blpI | 495671..495868 (+) | 198 | WP_001093258.1 | bacteriocin-like peptide BlpI | - |
| SPNOXC_RS02675 | cipB | 496335..496484 (+) | 150 | WP_001808912.1 | bacteriocin-like peptide BlpO | Regulator |
| SPNOXC_RS02680 (SPNOXC04970) | - | 496588..496707 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| SPNOXC_RS02690 (SPNOXC05000) | - | 497493..497876 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| SPNOXC_RS02695 (SPNOXC05010) | - | 497928..498617 (+) | 690 | WP_000760526.1 | CPBP family intramembrane glutamic endopeptidase | - |
| SPNOXC_RS02700 (SPNOXC05020) | blpZ | 498659..498907 (+) | 249 | WP_000276499.1 | immunity protein BlpZ | - |
| SPNOXC_RS02705 (SPNOXC05030) | - | 498937..499548 (+) | 612 | WP_000394047.1 | type II CAAX endopeptidase family protein | - |
| SPNOXC_RS02710 (SPNOXC05040) | - | 499709..500503 (+) | 795 | WP_000363002.1 | phosphotransferase family protein | - |
| SPNOXC_RS02715 (SPNOXC05050) | trmB | 500500..501135 (+) | 636 | WP_001266080.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5150.86 Da Isoelectric Point: 3.7098
>NTDB_id=39904 SPNOXC_RS02675 WP_001808912.1 496335..496484(+) (cipB) [Streptococcus pneumoniae OXC141]
MNTKMMSQFSVMDNEMLACVEGGDIDWGREISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGREISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=39904 SPNOXC_RS02675 WP_001808912.1 496335..496484(+) (cipB) [Streptococcus pneumoniae OXC141]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAGAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAGAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
51.02 |
100 |
0.51 |