Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   SPNOXC_RS02675 Genome accession   NC_017592
Coordinates   496335..496484 (+) Length   49 a.a.
NCBI ID   WP_001808912.1    Uniprot ID   -
Organism   Streptococcus pneumoniae OXC141     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 491335..501484
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SPNOXC_RS02650 (SPNOXC04890) blpC 491646..491801 (-) 156 WP_000358813.1 quorum-sensing system pheromone BlpC -
  SPNOXC_RS02655 (SPNOXC04900) - 491858..493219 (-) 1362 WP_001069092.1 bacteriocin secretion accessory protein -
  SPNOXC_RS13400 comA/nlmT 493230..493718 (-) 489 WP_307774349.1 ATP-binding cassette domain-containing protein Regulator
  SPNOXC_RS13405 comA/nlmT 493702..494142 (-) 441 WP_001808911.1 ATP-binding cassette domain-containing protein Regulator
  SPNOXC_RS13410 comA/nlmT 494132..494857 (-) 726 WP_167750760.1 ABC transporter transmembrane domain-containing protein Regulator
  SPNOXC_RS13415 (SPNOXC04920) comA/nlmT 494802..495389 (-) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator
  SPNOXC_RS02670 (SPNOXC04930) blpI 495671..495868 (+) 198 WP_001093258.1 bacteriocin-like peptide BlpI -
  SPNOXC_RS02675 cipB 496335..496484 (+) 150 WP_001808912.1 bacteriocin-like peptide BlpO Regulator
  SPNOXC_RS02680 (SPNOXC04970) - 496588..496707 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  SPNOXC_RS02690 (SPNOXC05000) - 497493..497876 (+) 384 WP_000877381.1 hypothetical protein -
  SPNOXC_RS02695 (SPNOXC05010) - 497928..498617 (+) 690 WP_000760526.1 CPBP family intramembrane glutamic endopeptidase -
  SPNOXC_RS02700 (SPNOXC05020) blpZ 498659..498907 (+) 249 WP_000276499.1 immunity protein BlpZ -
  SPNOXC_RS02705 (SPNOXC05030) - 498937..499548 (+) 612 WP_000394047.1 type II CAAX endopeptidase family protein -
  SPNOXC_RS02710 (SPNOXC05040) - 499709..500503 (+) 795 WP_000363002.1 phosphotransferase family protein -
  SPNOXC_RS02715 (SPNOXC05050) trmB 500500..501135 (+) 636 WP_001266080.1 tRNA (guanosine(46)-N7)-methyltransferase TrmB -

Sequence


Protein


Download         Length: 49 a.a.        Molecular weight: 5150.86 Da        Isoelectric Point: 3.7098

>NTDB_id=39904 SPNOXC_RS02675 WP_001808912.1 496335..496484(+) (cipB) [Streptococcus pneumoniae OXC141]
MNTKMMSQFSVMDNEMLACVEGGDIDWGREISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=39904 SPNOXC_RS02675 WP_001808912.1 496335..496484(+) (cipB) [Streptococcus pneumoniae OXC141]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAGAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51


Multiple sequence alignment