Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   GII76_RS16760 Genome accession   NZ_CP045826
Coordinates   3203659..3203799 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain 73     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3198659..3208799
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII76_RS16735 (GII76_16735) yuxO 3198972..3199352 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  GII76_RS16740 (GII76_16740) comA 3199371..3200015 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  GII76_RS16745 (GII76_16745) comP 3200096..3202405 (-) 2310 WP_015251333.1 two-component system sensor histidine kinase ComP Regulator
  GII76_RS16750 (GII76_16750) comX 3202420..3202587 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  GII76_RS16755 (GII76_16755) comQ 3202575..3203474 (-) 900 WP_015251332.1 ComX modifying isoprenyl transferase ComQ Regulator
  GII76_RS16760 (GII76_16760) degQ 3203659..3203799 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  GII76_RS16765 (GII76_16765) - 3204021..3204146 (+) 126 WP_003228793.1 hypothetical protein -
  GII76_RS16770 (GII76_16770) - 3204260..3204628 (+) 369 WP_014477834.1 hypothetical protein -
  GII76_RS16775 (GII76_16775) pdeH 3204604..3205833 (-) 1230 WP_024572553.1 cyclic di-GMP phosphodiesterase -
  GII76_RS16780 (GII76_16780) pncB 3205970..3207442 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  GII76_RS16785 (GII76_16785) pncA 3207458..3208009 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  GII76_RS16790 (GII76_16790) yueI 3208106..3208504 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=398410 GII76_RS16760 WP_003220708.1 3203659..3203799(-) (degQ) [Bacillus subtilis strain 73]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=398410 GII76_RS16760 WP_003220708.1 3203659..3203799(-) (degQ) [Bacillus subtilis strain 73]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment