Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   GII76_RS16750 Genome accession   NZ_CP045826
Coordinates   3202420..3202587 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis strain 73     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3197420..3207587
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII76_RS16720 (GII76_16720) mrpE 3197815..3198291 (+) 477 WP_003228815.1 Na+/H+ antiporter subunit E -
  GII76_RS16725 (GII76_16725) mrpF 3198291..3198575 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  GII76_RS16730 (GII76_16730) mnhG 3198559..3198933 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  GII76_RS16735 (GII76_16735) yuxO 3198972..3199352 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  GII76_RS16740 (GII76_16740) comA 3199371..3200015 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  GII76_RS16745 (GII76_16745) comP 3200096..3202405 (-) 2310 WP_015251333.1 two-component system sensor histidine kinase ComP Regulator
  GII76_RS16750 (GII76_16750) comX 3202420..3202587 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  GII76_RS16755 (GII76_16755) comQ 3202575..3203474 (-) 900 WP_015251332.1 ComX modifying isoprenyl transferase ComQ Regulator
  GII76_RS16760 (GII76_16760) degQ 3203659..3203799 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  GII76_RS16765 (GII76_16765) - 3204021..3204146 (+) 126 WP_003228793.1 hypothetical protein -
  GII76_RS16770 (GII76_16770) - 3204260..3204628 (+) 369 WP_014477834.1 hypothetical protein -
  GII76_RS16775 (GII76_16775) pdeH 3204604..3205833 (-) 1230 WP_024572553.1 cyclic di-GMP phosphodiesterase -
  GII76_RS16780 (GII76_16780) pncB 3205970..3207442 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=398408 GII76_RS16750 WP_003242801.1 3202420..3202587(-) (comX) [Bacillus subtilis strain 73]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=398408 GII76_RS16750 WP_003242801.1 3202420..3202587(-) (comX) [Bacillus subtilis strain 73]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment