Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   GII77_RS16560 Genome accession   NZ_CP045825
Coordinates   3185906..3186046 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain 75     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3180906..3191046
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII77_RS16535 (GII77_16535) yuxO 3181219..3181599 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  GII77_RS16540 (GII77_16540) comA 3181618..3182262 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  GII77_RS16545 (GII77_16545) comP 3182343..3184652 (-) 2310 WP_015251333.1 two-component system sensor histidine kinase ComP Regulator
  GII77_RS16550 (GII77_16550) comX 3184667..3184834 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  GII77_RS16555 (GII77_16555) comQ 3184822..3185721 (-) 900 WP_015251332.1 ComX modifying isoprenyl transferase ComQ Regulator
  GII77_RS16560 (GII77_16560) degQ 3185906..3186046 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  GII77_RS16565 (GII77_16565) - 3186268..3186393 (+) 126 WP_003228793.1 hypothetical protein -
  GII77_RS16570 (GII77_16570) - 3186507..3186875 (+) 369 WP_014477834.1 hypothetical protein -
  GII77_RS16575 (GII77_16575) pdeH 3186851..3188080 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  GII77_RS16580 (GII77_16580) pncB 3188217..3189689 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  GII77_RS16585 (GII77_16585) pncA 3189705..3190256 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  GII77_RS16590 (GII77_16590) yueI 3190353..3190751 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=398329 GII77_RS16560 WP_003220708.1 3185906..3186046(-) (degQ) [Bacillus subtilis strain 75]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=398329 GII77_RS16560 WP_003220708.1 3185906..3186046(-) (degQ) [Bacillus subtilis strain 75]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment