Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   GII78_RS17180 Genome accession   NZ_CP045824
Coordinates   3265666..3265806 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain MB8_B10     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3260666..3270806
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII78_RS17155 (GII78_17155) yuxO 3260943..3261323 (-) 381 WP_015714624.1 hotdog fold thioesterase -
  GII78_RS17160 (GII78_17160) comA 3261342..3261986 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  GII78_RS17165 (GII78_17165) comP 3262067..3264379 (-) 2313 WP_069703660.1 histidine kinase Regulator
  GII78_RS17170 (GII78_17170) comX 3264395..3264616 (-) 222 WP_014480704.1 competence pheromone ComX -
  GII78_RS17175 (GII78_17175) - 3264618..3265481 (-) 864 WP_043858576.1 polyprenyl synthetase family protein -
  GII78_RS17180 (GII78_17180) degQ 3265666..3265806 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  GII78_RS17185 (GII78_17185) - 3266028..3266153 (+) 126 WP_003228793.1 hypothetical protein -
  GII78_RS17190 (GII78_17190) - 3266267..3266635 (+) 369 WP_014477834.1 hypothetical protein -
  GII78_RS17195 (GII78_17195) pdeH 3266611..3267840 (-) 1230 WP_003228790.1 cyclic di-GMP phosphodiesterase -
  GII78_RS17200 (GII78_17200) pncB 3267977..3269449 (-) 1473 WP_019712928.1 nicotinate phosphoribosyltransferase -
  GII78_RS17205 (GII78_17205) pncA 3269465..3270016 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  GII78_RS17210 (GII78_17210) yueI 3270113..3270511 (-) 399 WP_019712929.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=398248 GII78_RS17180 WP_003220708.1 3265666..3265806(-) (degQ) [Bacillus subtilis strain MB8_B10]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=398248 GII78_RS17180 WP_003220708.1 3265666..3265806(-) (degQ) [Bacillus subtilis strain MB8_B10]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment