Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   GII79_RS13220 Genome accession   NZ_CP045823
Coordinates   2542787..2543170 (-) Length   127 a.a.
NCBI ID   WP_029726721.1    Uniprot ID   -
Organism   Bacillus subtilis strain MB8_B1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2537787..2548170
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII79_RS13180 (GII79_13180) sinI 2538720..2538893 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  GII79_RS13185 (GII79_13185) sinR 2538927..2539262 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  GII79_RS13190 (GII79_13190) tasA 2539355..2540140 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  GII79_RS13195 (GII79_13195) sipW 2540204..2540776 (-) 573 WP_072692741.1 signal peptidase I SipW -
  GII79_RS13200 (GII79_13200) tapA 2540760..2541521 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  GII79_RS13205 (GII79_13205) yqzG 2541793..2542119 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  GII79_RS13210 (GII79_13210) spoIITA 2542161..2542340 (-) 180 WP_029726723.1 YqzE family protein -
  GII79_RS13215 (GII79_13215) comGG 2542412..2542786 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  GII79_RS13220 (GII79_13220) comGF 2542787..2543170 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  GII79_RS13225 (GII79_13225) comGE 2543196..2543543 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  GII79_RS13230 (GII79_13230) comGD 2543527..2543958 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  GII79_RS13235 (GII79_13235) comGC 2543948..2544244 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  GII79_RS13240 (GII79_13240) comGB 2544258..2545295 (-) 1038 WP_029726718.1 comG operon protein ComGB Machinery gene
  GII79_RS13245 (GII79_13245) comGA 2545282..2546352 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  GII79_RS13250 (GII79_13250) - 2546565..2546762 (-) 198 WP_029726717.1 hypothetical protein -
  GII79_RS13255 (GII79_13255) corA 2546764..2547717 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14409.52 Da        Isoelectric Point: 5.8940

>NTDB_id=398148 GII79_RS13220 WP_029726721.1 2542787..2543170(-) (comGF) [Bacillus subtilis strain MB8_B1]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENCVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=398148 GII79_RS13220 WP_029726721.1 2542787..2543170(-) (comGF) [Bacillus subtilis strain MB8_B1]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATTGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

96.85

100

0.969


Multiple sequence alignment