Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   GII79_RS13180 Genome accession   NZ_CP045823
Coordinates   2538720..2538893 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain MB8_B1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2533720..2543893
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII79_RS13165 (GII79_13165) gcvT 2534520..2535608 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  GII79_RS13170 (GII79_13170) hepAA 2536049..2537722 (+) 1674 WP_029726726.1 SNF2-related protein -
  GII79_RS13175 (GII79_13175) yqhG 2537743..2538537 (+) 795 WP_015714249.1 YqhG family protein -
  GII79_RS13180 (GII79_13180) sinI 2538720..2538893 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  GII79_RS13185 (GII79_13185) sinR 2538927..2539262 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  GII79_RS13190 (GII79_13190) tasA 2539355..2540140 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  GII79_RS13195 (GII79_13195) sipW 2540204..2540776 (-) 573 WP_072692741.1 signal peptidase I SipW -
  GII79_RS13200 (GII79_13200) tapA 2540760..2541521 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  GII79_RS13205 (GII79_13205) yqzG 2541793..2542119 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  GII79_RS13210 (GII79_13210) spoIITA 2542161..2542340 (-) 180 WP_029726723.1 YqzE family protein -
  GII79_RS13215 (GII79_13215) comGG 2542412..2542786 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  GII79_RS13220 (GII79_13220) comGF 2542787..2543170 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  GII79_RS13225 (GII79_13225) comGE 2543196..2543543 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=398145 GII79_RS13180 WP_003230187.1 2538720..2538893(+) (sinI) [Bacillus subtilis strain MB8_B1]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=398145 GII79_RS13180 WP_003230187.1 2538720..2538893(+) (sinI) [Bacillus subtilis strain MB8_B1]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment