Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   GII80_RS17040 Genome accession   NZ_CP045821
Coordinates   3236679..3236846 (-) Length   55 a.a.
NCBI ID   WP_153932906.1    Uniprot ID   -
Organism   Bacillus subtilis strain MB8_B7     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3231679..3241846
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII80_RS17010 (GII80_17010) mrpE 3232074..3232550 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  GII80_RS17015 (GII80_17015) mrpF 3232550..3232834 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  GII80_RS17020 (GII80_17020) mnhG 3232818..3233192 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  GII80_RS17025 (GII80_17025) yuxO 3233231..3233611 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  GII80_RS17030 (GII80_17030) comA 3233630..3234274 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  GII80_RS17035 (GII80_17035) comP 3234355..3236664 (-) 2310 WP_015251333.1 two-component system sensor histidine kinase ComP Regulator
  GII80_RS17040 (GII80_17040) comX 3236679..3236846 (-) 168 WP_153932906.1 competence pheromone ComX Regulator
  GII80_RS17045 (GII80_17045) comQ 3236834..3237733 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  GII80_RS17050 (GII80_17050) degQ 3237918..3238058 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  GII80_RS17055 (GII80_17055) - 3238280..3238405 (+) 126 WP_003228793.1 hypothetical protein -
  GII80_RS17060 (GII80_17060) - 3238519..3238887 (+) 369 WP_003243784.1 hypothetical protein -
  GII80_RS17065 (GII80_17065) pdeH 3238863..3240092 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  GII80_RS17070 (GII80_17070) pncB 3240229..3241701 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6492.38 Da        Isoelectric Point: 4.5636

>NTDB_id=398088 GII80_RS17040 WP_153932906.1 3236679..3236846(-) (comX) [Bacillus subtilis strain MB8_B7]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAHNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=398088 GII80_RS17040 WP_153932906.1 3236679..3236846(-) (comX) [Bacillus subtilis strain MB8_B7]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTCATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

98.182

100

0.982


Multiple sequence alignment