Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   GII80_RS13185 Genome accession   NZ_CP045821
Coordinates   2533268..2533441 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain MB8_B7     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2528268..2538441
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII80_RS13170 (GII80_13170) gcvT 2529067..2530155 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  GII80_RS13175 (GII80_13175) hepAA 2530597..2532270 (+) 1674 WP_004398544.1 SNF2-related protein -
  GII80_RS13180 (GII80_13180) yqhG 2532291..2533085 (+) 795 WP_003230200.1 YqhG family protein -
  GII80_RS13185 (GII80_13185) sinI 2533268..2533441 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  GII80_RS13190 (GII80_13190) sinR 2533475..2533810 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  GII80_RS13195 (GII80_13195) tasA 2533903..2534688 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  GII80_RS13200 (GII80_13200) sipW 2534752..2535324 (-) 573 WP_003246088.1 signal peptidase I SipW -
  GII80_RS13205 (GII80_13205) tapA 2535308..2536069 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  GII80_RS13210 (GII80_13210) yqzG 2536341..2536667 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  GII80_RS13215 (GII80_13215) spoIITA 2536709..2536888 (-) 180 WP_003230176.1 YqzE family protein -
  GII80_RS13220 (GII80_13220) comGG 2536959..2537333 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  GII80_RS13225 (GII80_13225) comGF 2537334..2537717 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  GII80_RS13230 (GII80_13230) comGE 2537743..2538090 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=398064 GII80_RS13185 WP_003230187.1 2533268..2533441(+) (sinI) [Bacillus subtilis strain MB8_B7]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=398064 GII80_RS13185 WP_003230187.1 2533268..2533441(+) (sinI) [Bacillus subtilis strain MB8_B7]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment