Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   GII80_RS13225 Genome accession   NZ_CP045821
Coordinates   2537334..2537717 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis strain MB8_B7     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2532334..2542717
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII80_RS13185 (GII80_13185) sinI 2533268..2533441 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  GII80_RS13190 (GII80_13190) sinR 2533475..2533810 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  GII80_RS13195 (GII80_13195) tasA 2533903..2534688 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  GII80_RS13200 (GII80_13200) sipW 2534752..2535324 (-) 573 WP_003246088.1 signal peptidase I SipW -
  GII80_RS13205 (GII80_13205) tapA 2535308..2536069 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  GII80_RS13210 (GII80_13210) yqzG 2536341..2536667 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  GII80_RS13215 (GII80_13215) spoIITA 2536709..2536888 (-) 180 WP_003230176.1 YqzE family protein -
  GII80_RS13220 (GII80_13220) comGG 2536959..2537333 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  GII80_RS13225 (GII80_13225) comGF 2537334..2537717 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  GII80_RS13230 (GII80_13230) comGE 2537743..2538090 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  GII80_RS13235 (GII80_13235) comGD 2538074..2538505 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  GII80_RS13240 (GII80_13240) comGC 2538495..2538791 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  GII80_RS13245 (GII80_13245) comGB 2538805..2539842 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  GII80_RS13250 (GII80_13250) comGA 2539829..2540899 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  GII80_RS13255 (GII80_13255) corA 2541311..2542264 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=398067 GII80_RS13225 WP_003230168.1 2537334..2537717(-) (comGF) [Bacillus subtilis strain MB8_B7]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=398067 GII80_RS13225 WP_003230168.1 2537334..2537717(-) (comGF) [Bacillus subtilis strain MB8_B7]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment