Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   GII82_RS16260 Genome accession   NZ_CP045819
Coordinates   3142541..3142708 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis strain MB9_B4     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3137541..3147708
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII82_RS16230 (GII82_16230) mrpE 3137936..3138412 (+) 477 WP_003228815.1 Na+/H+ antiporter subunit E -
  GII82_RS16235 (GII82_16235) mrpF 3138412..3138696 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  GII82_RS16240 (GII82_16240) mnhG 3138680..3139054 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  GII82_RS16245 (GII82_16245) yuxO 3139093..3139473 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  GII82_RS16250 (GII82_16250) comA 3139492..3140136 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  GII82_RS16255 (GII82_16255) comP 3140217..3142526 (-) 2310 WP_015251333.1 two-component system sensor histidine kinase ComP Regulator
  GII82_RS16260 (GII82_16260) comX 3142541..3142708 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  GII82_RS16265 (GII82_16265) comQ 3142696..3143595 (-) 900 WP_015251332.1 ComX modifying isoprenyl transferase ComQ Regulator
  GII82_RS16270 (GII82_16270) degQ 3143780..3143920 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  GII82_RS16275 (GII82_16275) - 3144142..3144267 (+) 126 WP_003228793.1 hypothetical protein -
  GII82_RS16280 (GII82_16280) - 3144381..3144749 (+) 369 WP_014477834.1 hypothetical protein -
  GII82_RS16285 (GII82_16285) pdeH 3144725..3145954 (-) 1230 WP_024572553.1 cyclic di-GMP phosphodiesterase -
  GII82_RS16290 (GII82_16290) pncB 3146091..3147563 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=397923 GII82_RS16260 WP_003242801.1 3142541..3142708(-) (comX) [Bacillus subtilis strain MB9_B4]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=397923 GII82_RS16260 WP_003242801.1 3142541..3142708(-) (comX) [Bacillus subtilis strain MB9_B4]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment