Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   GII83_RS12300 Genome accession   NZ_CP045818
Coordinates   2409474..2409848 (-) Length   124 a.a.
NCBI ID   WP_029726722.1    Uniprot ID   -
Organism   Bacillus subtilis strain MB9_B6     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2404474..2414848
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII83_RS12260 (GII83_12260) yqhG 2404806..2405600 (+) 795 WP_015714249.1 YqhG family protein -
  GII83_RS12265 (GII83_12265) sinI 2405783..2405956 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  GII83_RS12270 (GII83_12270) sinR 2405990..2406325 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  GII83_RS12275 (GII83_12275) tasA 2406418..2407203 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  GII83_RS12280 (GII83_12280) sipW 2407267..2407839 (-) 573 WP_072692741.1 signal peptidase I SipW -
  GII83_RS12285 (GII83_12285) tapA 2407823..2408584 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  GII83_RS12290 (GII83_12290) yqzG 2408855..2409181 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  GII83_RS12295 (GII83_12295) spoIITA 2409223..2409402 (-) 180 WP_029726723.1 YqzE family protein -
  GII83_RS12300 (GII83_12300) comGG 2409474..2409848 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  GII83_RS12305 (GII83_12305) comGF 2409849..2410232 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  GII83_RS12310 (GII83_12310) comGE 2410258..2410605 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  GII83_RS12315 (GII83_12315) comGD 2410589..2411020 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  GII83_RS12320 (GII83_12320) comGC 2411010..2411306 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  GII83_RS12325 (GII83_12325) comGB 2411320..2412357 (-) 1038 WP_029726718.1 comG operon protein ComGB Machinery gene
  GII83_RS12330 (GII83_12330) comGA 2412344..2413414 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  GII83_RS12335 (GII83_12335) - 2413627..2413824 (-) 198 WP_029726717.1 hypothetical protein -
  GII83_RS12340 (GII83_12340) corA 2413826..2414779 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14443.63 Da        Isoelectric Point: 7.8383

>NTDB_id=397822 GII83_RS12300 WP_029726722.1 2409474..2409848(-) (comGG) [Bacillus subtilis strain MB9_B6]
MYCTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSVRHVLEERKGQEGTEQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=397822 GII83_RS12300 WP_029726722.1 2409474..2409848(-) (comGG) [Bacillus subtilis strain MB9_B6]
ATGTATTGTACAAGAGGGTTTATTTACCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGGTCCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGGAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

95.161

100

0.952

Multiple sequence alignment