Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   GII83_RS12265 Genome accession   NZ_CP045818
Coordinates   2405783..2405956 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain MB9_B6     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2400783..2410956
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII83_RS12250 (GII83_12250) gcvT 2401583..2402671 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  GII83_RS12255 (GII83_12255) hepAA 2403112..2404785 (+) 1674 WP_029726726.1 SNF2-related protein -
  GII83_RS12260 (GII83_12260) yqhG 2404806..2405600 (+) 795 WP_015714249.1 YqhG family protein -
  GII83_RS12265 (GII83_12265) sinI 2405783..2405956 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  GII83_RS12270 (GII83_12270) sinR 2405990..2406325 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  GII83_RS12275 (GII83_12275) tasA 2406418..2407203 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  GII83_RS12280 (GII83_12280) sipW 2407267..2407839 (-) 573 WP_072692741.1 signal peptidase I SipW -
  GII83_RS12285 (GII83_12285) tapA 2407823..2408584 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  GII83_RS12290 (GII83_12290) yqzG 2408855..2409181 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  GII83_RS12295 (GII83_12295) spoIITA 2409223..2409402 (-) 180 WP_029726723.1 YqzE family protein -
  GII83_RS12300 (GII83_12300) comGG 2409474..2409848 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  GII83_RS12305 (GII83_12305) comGF 2409849..2410232 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  GII83_RS12310 (GII83_12310) comGE 2410258..2410605 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=397820 GII83_RS12265 WP_003230187.1 2405783..2405956(+) (sinI) [Bacillus subtilis strain MB9_B6]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=397820 GII83_RS12265 WP_003230187.1 2405783..2405956(+) (sinI) [Bacillus subtilis strain MB9_B6]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment