Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   GII85_RS12435 Genome accession   NZ_CP045817
Coordinates   2439358..2439531 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain P5_B1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2434358..2444531
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII85_RS12420 (GII85_12420) gcvT 2435158..2436246 (-) 1089 WP_041850013.1 glycine cleavage system aminomethyltransferase GcvT -
  GII85_RS12425 (GII85_12425) hepAA 2436687..2438360 (+) 1674 WP_041850014.1 SNF2-related protein -
  GII85_RS12430 (GII85_12430) yqhG 2438381..2439175 (+) 795 WP_003230200.1 YqhG family protein -
  GII85_RS12435 (GII85_12435) sinI 2439358..2439531 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  GII85_RS12440 (GII85_12440) sinR 2439565..2439900 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  GII85_RS12445 (GII85_12445) tasA 2439993..2440778 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  GII85_RS12450 (GII85_12450) sipW 2440842..2441414 (-) 573 WP_003246088.1 signal peptidase I SipW -
  GII85_RS12455 (GII85_12455) tapA 2441398..2442159 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  GII85_RS12460 (GII85_12460) yqzG 2442431..2442757 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  GII85_RS12465 (GII85_12465) spoIITA 2442799..2442978 (-) 180 WP_003230176.1 YqzE family protein -
  GII85_RS12470 (GII85_12470) comGG 2443049..2443423 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  GII85_RS12475 (GII85_12475) comGF 2443424..2443807 (-) 384 WP_041850015.1 ComG operon protein ComGF Machinery gene
  GII85_RS12480 (GII85_12480) comGE 2443833..2444180 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=397741 GII85_RS12435 WP_003230187.1 2439358..2439531(+) (sinI) [Bacillus subtilis strain P5_B1]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=397741 GII85_RS12435 WP_003230187.1 2439358..2439531(+) (sinI) [Bacillus subtilis strain P5_B1]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment