Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   GII85_RS12475 Genome accession   NZ_CP045817
Coordinates   2443424..2443807 (-) Length   127 a.a.
NCBI ID   WP_041850015.1    Uniprot ID   -
Organism   Bacillus subtilis strain P5_B1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2438424..2448807
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII85_RS12435 (GII85_12435) sinI 2439358..2439531 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  GII85_RS12440 (GII85_12440) sinR 2439565..2439900 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  GII85_RS12445 (GII85_12445) tasA 2439993..2440778 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  GII85_RS12450 (GII85_12450) sipW 2440842..2441414 (-) 573 WP_003246088.1 signal peptidase I SipW -
  GII85_RS12455 (GII85_12455) tapA 2441398..2442159 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  GII85_RS12460 (GII85_12460) yqzG 2442431..2442757 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  GII85_RS12465 (GII85_12465) spoIITA 2442799..2442978 (-) 180 WP_003230176.1 YqzE family protein -
  GII85_RS12470 (GII85_12470) comGG 2443049..2443423 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  GII85_RS12475 (GII85_12475) comGF 2443424..2443807 (-) 384 WP_041850015.1 ComG operon protein ComGF Machinery gene
  GII85_RS12480 (GII85_12480) comGE 2443833..2444180 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  GII85_RS12485 (GII85_12485) comGD 2444164..2444595 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  GII85_RS12490 (GII85_12490) comGC 2444585..2444881 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  GII85_RS12495 (GII85_12495) comGB 2444895..2445932 (-) 1038 WP_041850016.1 comG operon protein ComGB Machinery gene
  GII85_RS12500 (GII85_12500) comGA 2445919..2446989 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  GII85_RS12505 (GII85_12505) corA 2447400..2448353 (-) 954 WP_029317911.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14250.41 Da        Isoelectric Point: 6.4838

>NTDB_id=397744 GII85_RS12475 WP_041850015.1 2443424..2443807(-) (comGF) [Bacillus subtilis strain P5_B1]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHIAAMKADIKNGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=397744 GII85_RS12475 WP_041850015.1 2443424..2443807(-) (comGF) [Bacillus subtilis strain P5_B1]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCTATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTGCTGCCATGAAAGCTGATATTAAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACAGCTTTTCCGGTCTATTCGTATTTAGGAGGAGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984


Multiple sequence alignment