Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   GII86_RS12635 Genome accession   NZ_CP045816
Coordinates   2372825..2373199 (-) Length   124 a.a.
NCBI ID   WP_014480253.1    Uniprot ID   A0AA96ZSW7
Organism   Bacillus subtilis strain P5_B2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2367825..2378199
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII86_RS12595 (GII86_12595) yqhG 2368155..2368949 (+) 795 WP_046160581.1 YqhG family protein -
  GII86_RS12600 (GII86_12600) sinI 2369133..2369306 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  GII86_RS12605 (GII86_12605) sinR 2369340..2369675 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  GII86_RS12610 (GII86_12610) tasA 2369767..2370552 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  GII86_RS12615 (GII86_12615) sipW 2370617..2371189 (-) 573 WP_003230181.1 signal peptidase I SipW -
  GII86_RS12620 (GII86_12620) tapA 2371173..2371934 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  GII86_RS12625 (GII86_12625) yqzG 2372206..2372532 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  GII86_RS12630 (GII86_12630) spoIITA 2372574..2372753 (-) 180 WP_029726723.1 YqzE family protein -
  GII86_RS12635 (GII86_12635) comGG 2372825..2373199 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  GII86_RS12640 (GII86_12640) comGF 2373200..2373583 (-) 384 WP_046160582.1 ComG operon protein ComGF Machinery gene
  GII86_RS12645 (GII86_12645) comGE 2373609..2373956 (-) 348 WP_046160583.1 ComG operon protein 5 Machinery gene
  GII86_RS12650 (GII86_12650) comGD 2373940..2374371 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  GII86_RS12655 (GII86_12655) comGC 2374361..2374657 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  GII86_RS12660 (GII86_12660) comGB 2374671..2375708 (-) 1038 WP_029317912.1 comG operon protein ComGB Machinery gene
  GII86_RS12665 (GII86_12665) comGA 2375695..2376765 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  GII86_RS12670 (GII86_12670) - 2376977..2377174 (-) 198 WP_046160584.1 CBS domain-containing protein -
  GII86_RS12675 (GII86_12675) corA 2377176..2378129 (-) 954 WP_046160585.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14509.72 Da        Isoelectric Point: 9.2806

>NTDB_id=397663 GII86_RS12635 WP_014480253.1 2372825..2373199(-) (comGG) [Bacillus subtilis strain P5_B2]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=397663 GII86_RS12635 WP_014480253.1 2372825..2373199(-) (comGG) [Bacillus subtilis strain P5_B2]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAAAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTATTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

97.581

100

0.976


Multiple sequence alignment