Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   GII86_RS12600 Genome accession   NZ_CP045816
Coordinates   2369133..2369306 (+) Length   57 a.a.
NCBI ID   WP_014477323.1    Uniprot ID   -
Organism   Bacillus subtilis strain P5_B2     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2364133..2374306
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII86_RS12585 (GII86_12585) gcvT 2364931..2366019 (-) 1089 WP_038829737.1 glycine cleavage system aminomethyltransferase GcvT -
  GII86_RS12590 (GII86_12590) hepAA 2366461..2368134 (+) 1674 WP_038829735.1 SNF2-related protein -
  GII86_RS12595 (GII86_12595) yqhG 2368155..2368949 (+) 795 WP_046160581.1 YqhG family protein -
  GII86_RS12600 (GII86_12600) sinI 2369133..2369306 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  GII86_RS12605 (GII86_12605) sinR 2369340..2369675 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  GII86_RS12610 (GII86_12610) tasA 2369767..2370552 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  GII86_RS12615 (GII86_12615) sipW 2370617..2371189 (-) 573 WP_003230181.1 signal peptidase I SipW -
  GII86_RS12620 (GII86_12620) tapA 2371173..2371934 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  GII86_RS12625 (GII86_12625) yqzG 2372206..2372532 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  GII86_RS12630 (GII86_12630) spoIITA 2372574..2372753 (-) 180 WP_029726723.1 YqzE family protein -
  GII86_RS12635 (GII86_12635) comGG 2372825..2373199 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  GII86_RS12640 (GII86_12640) comGF 2373200..2373583 (-) 384 WP_046160582.1 ComG operon protein ComGF Machinery gene
  GII86_RS12645 (GII86_12645) comGE 2373609..2373956 (-) 348 WP_046160583.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6633.58 Da        Isoelectric Point: 6.7231

>NTDB_id=397661 GII86_RS12600 WP_014477323.1 2369133..2369306(+) (sinI) [Bacillus subtilis strain P5_B2]
MKNAKQEHFELDQEWVELMMEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=397661 GII86_RS12600 WP_014477323.1 2369133..2369306(+) (sinI) [Bacillus subtilis strain P5_B2]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTGATGATGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

98.246

100

0.982

Multiple sequence alignment