Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BSN5_RS06830 Genome accession   NC_014976
Coordinates   1264494..1264634 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis BSn5     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1259494..1269634
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSN5_RS06805 (BSn5_06730) yuxO 1259770..1260150 (-) 381 WP_015714624.1 hotdog fold thioesterase -
  BSN5_RS06810 (BSn5_06735) comA 1260169..1260813 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  BSN5_RS06815 (BSn5_06740) comP 1260894..1263206 (-) 2313 WP_015714625.1 histidine kinase Regulator
  BSN5_RS06820 (BSn5_06745) comX 1263222..1263443 (-) 222 WP_014114983.1 competence pheromone ComX -
  BSN5_RS06825 (BSn5_06750) - 1263440..1264309 (-) 870 WP_015714626.1 polyprenyl synthetase family protein -
  BSN5_RS06830 (BSn5_06755) degQ 1264494..1264634 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  BSN5_RS21935 - 1264856..1264981 (+) 126 WP_141770195.1 hypothetical protein -
  BSN5_RS06835 (BSn5_06760) - 1265096..1265464 (+) 369 WP_014477834.1 hypothetical protein -
  BSN5_RS06840 (BSn5_06765) pdeH 1265440..1266669 (-) 1230 WP_014477835.1 cyclic di-GMP phosphodiesterase -
  BSN5_RS06845 (BSn5_06770) pncB 1266806..1268278 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  BSN5_RS06850 (BSn5_06775) pncA 1268294..1268845 (-) 552 WP_015714627.1 isochorismatase family cysteine hydrolase -
  BSN5_RS06855 (BSn5_06780) yueI 1268942..1269340 (-) 399 WP_015714628.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=39761 BSN5_RS06830 WP_003220708.1 1264494..1264634(-) (degQ) [Bacillus subtilis BSn5]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=39761 BSN5_RS06830 WP_003220708.1 1264494..1264634(-) (degQ) [Bacillus subtilis BSn5]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment