Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   GII90_RS16055 Genome accession   NZ_CP045811
Coordinates   3103398..3103565 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis strain P9_B1     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3098398..3108565
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GII90_RS16025 (GII90_16025) mrpE 3098793..3099269 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  GII90_RS16030 (GII90_16030) mrpF 3099269..3099553 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  GII90_RS16035 (GII90_16035) mnhG 3099537..3099911 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  GII90_RS16040 (GII90_16040) yuxO 3099950..3100330 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  GII90_RS16045 (GII90_16045) comA 3100349..3100993 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  GII90_RS16050 (GII90_16050) comP 3101074..3103383 (-) 2310 WP_153940278.1 two-component system sensor histidine kinase ComP Regulator
  GII90_RS16055 (GII90_16055) comX 3103398..3103565 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  GII90_RS16060 (GII90_16060) comQ 3103553..3104452 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  GII90_RS16065 (GII90_16065) degQ 3104637..3104777 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  GII90_RS16070 (GII90_16070) - 3104999..3105124 (+) 126 WP_003228793.1 hypothetical protein -
  GII90_RS16075 (GII90_16075) - 3105238..3105606 (+) 369 WP_003243784.1 hypothetical protein -
  GII90_RS16080 (GII90_16080) pdeH 3105582..3106811 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  GII90_RS16085 (GII90_16085) pncB 3106948..3108420 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=397446 GII90_RS16055 WP_003242801.1 3103398..3103565(-) (comX) [Bacillus subtilis strain P9_B1]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=397446 GII90_RS16055 WP_003242801.1 3103398..3103565(-) (comX) [Bacillus subtilis strain P9_B1]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment