Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   GE073_RS24830 Genome accession   NZ_CP045802
Coordinates   5809315..5809884 (-) Length   189 a.a.
NCBI ID   WP_153784611.1    Uniprot ID   -
Organism   Paenibacillus sp. B01     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 5776948..5810202 5809315..5809884 within 0


Gene organization within MGE regions


Location: 5776948..5810202
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GE073_RS24650 (GE073_24650) - 5776948..5777385 (-) 438 WP_028406245.1 Hsp20/alpha crystallin family protein -
  GE073_RS24655 (GE073_24655) - 5777580..5778623 (-) 1044 WP_153784603.1 ATP-binding protein -
  GE073_RS24660 (GE073_24660) - 5778782..5780956 (-) 2175 WP_153784604.1 PAS domain S-box protein -
  GE073_RS24665 (GE073_24665) tnpA 5781326..5781799 (-) 474 WP_007128375.1 IS200/IS605 family transposase -
  GE073_RS24670 (GE073_24670) - 5782050..5783464 (+) 1415 Protein_4880 IS1182 family transposase -
  GE073_RS24675 (GE073_24675) dpsA 5783579..5784505 (-) 927 WP_128630792.1 dipicolinate synthase subunit DpsA -
  GE073_RS24680 (GE073_24680) - 5784542..5784856 (-) 315 WP_021624005.1 YunC family protein -
  GE073_RS24685 (GE073_24685) - 5785024..5786541 (-) 1518 WP_101807380.1 phospholipase D-like domain-containing protein -
  GE073_RS24690 (GE073_24690) - 5786621..5786827 (-) 207 WP_101807379.1 DUF1657 domain-containing protein -
  GE073_RS24695 (GE073_24695) - 5786916..5787335 (-) 420 WP_228551775.1 CBO0543 family protein -
  GE073_RS24700 (GE073_24700) - 5787635..5788108 (-) 474 WP_153784605.1 hypothetical protein -
  GE073_RS24705 (GE073_24705) - 5788645..5789742 (-) 1098 WP_194843488.1 Ger(x)C family spore germination protein -
  GE073_RS24710 (GE073_24710) - 5789723..5790880 (-) 1158 WP_153784607.1 GerAB/ArcD/ProY family transporter -
  GE073_RS24715 (GE073_24715) - 5790880..5792370 (-) 1491 WP_228551777.1 spore germination protein -
  GE073_RS24720 (GE073_24720) - 5792907..5793110 (-) 204 WP_101807375.1 hypothetical protein -
  GE073_RS24725 (GE073_24725) - 5793337..5793510 (+) 174 WP_153784608.1 hypothetical protein -
  GE073_RS24730 (GE073_24730) spoVAE 5793685..5794035 (-) 351 WP_005832063.1 stage V sporulation protein AE -
  GE073_RS24735 (GE073_24735) spoVAD 5794032..5795051 (-) 1020 WP_127510464.1 stage V sporulation protein AD -
  GE073_RS24740 (GE073_24740) spoVAC 5795053..5795532 (-) 480 WP_005832062.1 stage V sporulation protein AC -
  GE073_RS24745 (GE073_24745) - 5795569..5796429 (-) 861 WP_153784609.1 DUF421 domain-containing protein -
  GE073_RS24750 (GE073_24750) - 5796640..5796846 (+) 207 WP_007781230.1 DUF1657 domain-containing protein -
  GE073_RS24755 (GE073_24755) - 5797726..5798769 (-) 1044 WP_101807371.1 hypothetical protein -
  GE073_RS26010 (GE073_24760) - 5798991..5799404 (-) 414 WP_280522965.1 CBO0543 family protein -
  GE073_RS26115 (GE073_24765) - 5800311..5800385 (-) 75 WP_081494688.1 CHASE3 domain-containing protein -
  GE073_RS26120 - 5800585..5801243 (-) 659 Protein_4900 spore germination protein -
  GE073_RS24785 (GE073_24785) - 5801201..5801725 (-) 525 WP_035316911.1 spore germination protein -
  GE073_RS24790 (GE073_24790) - 5802098..5802301 (-) 204 WP_101807367.1 hypothetical protein -
  GE073_RS24795 (GE073_24795) - 5802499..5802747 (+) 249 WP_107338596.1 YuzF family protein -
  GE073_RS24800 (GE073_24800) - 5802830..5803726 (+) 897 WP_054943616.1 manganese catalase family protein -
  GE073_RS24805 (GE073_24805) - 5803864..5804310 (-) 447 WP_005828377.1 DUF6262 family protein -
  GE073_RS24810 (GE073_24810) - 5804307..5805938 (-) 1632 WP_153784610.1 tyrosine-type recombinase/integrase -
  GE073_RS24815 (GE073_24815) - 5805931..5807328 (-) 1398 WP_054943613.1 tyrosine-type recombinase/integrase -
  GE073_RS24820 (GE073_24820) - 5807325..5808473 (-) 1149 WP_228551779.1 tyrosine-type recombinase/integrase -
  GE073_RS24825 (GE073_24825) rpsR 5808688..5808972 (-) 285 WP_023559051.1 30S ribosomal protein S18 -
  GE073_RS24830 (GE073_24830) ssbA 5809315..5809884 (-) 570 WP_153784611.1 single-stranded DNA-binding protein Machinery gene
  GE073_RS24835 (GE073_24835) rpsF 5809918..5810202 (-) 285 WP_153784612.1 30S ribosomal protein S6 -

Sequence


Protein


Download         Length: 189 a.a.        Molecular weight: 19849.47 Da        Isoelectric Point: 4.8536

>NTDB_id=397347 GE073_RS24830 WP_153784611.1 5809315..5809884(-) (ssbA) [Paenibacillus sp. B01]
MLNRVILIGRLTRDPELRYTPSGVAVTQFTLAVDRPFNSQSGEREADFIPIVTWRQLAETCANYLRKGRLAAVEGRMQVR
NYENNEGKRVYVTEIIADNVRFLESGNRENAPREEGSYSGGGSSGNGGGGGNYGGGNGGYGGGGQSGGGSQGGGSYGGNR
GGGGGSSNSRDPFSDDGRPIDISEDDLPF

Nucleotide


Download         Length: 570 bp        

>NTDB_id=397347 GE073_RS24830 WP_153784611.1 5809315..5809884(-) (ssbA) [Paenibacillus sp. B01]
ATGTTGAACCGTGTCATTCTGATCGGCAGGCTCACCCGAGATCCGGAGCTTCGCTATACCCCTTCGGGAGTTGCGGTCAC
GCAATTCACGCTGGCGGTGGATCGGCCCTTCAACAGCCAATCCGGCGAGCGCGAAGCCGATTTCATTCCGATCGTCACCT
GGAGGCAGCTTGCCGAAACCTGCGCCAACTATTTGCGCAAAGGTCGTCTGGCAGCAGTCGAAGGCCGGATGCAAGTCCGG
AACTATGAGAACAACGAAGGCAAGCGCGTCTACGTGACGGAAATCATTGCCGACAATGTTCGGTTCCTGGAGTCCGGCAA
CCGCGAGAACGCTCCGCGTGAGGAAGGCTCTTACAGCGGCGGCGGAAGCAGCGGCAACGGCGGCGGCGGTGGAAATTACG
GCGGCGGCAACGGAGGCTACGGCGGCGGCGGCCAATCGGGCGGCGGAAGCCAAGGCGGAGGTTCCTACGGGGGCAATCGC
GGCGGCGGTGGTGGTTCTTCCAACAGCCGGGATCCATTCTCGGATGACGGACGTCCGATCGACATCTCCGAAGATGATTT
GCCATTTTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

53.439

100

0.534

  ssb Latilactobacillus sakei subsp. sakei 23K

45.263

100

0.455


Multiple sequence alignment