Detailed information    

insolico Bioinformatically predicted

Overview


Name   crp   Type   Regulator
Locus tag   HIBPF_RS06425 Genome accession   NC_014920
Coordinates   1271245..1271919 (-) Length   224 a.a.
NCBI ID   WP_005647998.1    Uniprot ID   Q4QLV0
Organism   Haemophilus influenzae F3031     
Function   promote expression of competence genes (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1249277..1280490 1271245..1271919 within 0


Gene organization within MGE regions


Location: 1249277..1280490
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HIBPF_RS06260 (HIBPF12940) - 1249277..1249708 (-) 432 WP_013526153.1 gp436 family protein -
  HIBPF_RS06265 (HIBPF12970) - 1249718..1250053 (-) 336 WP_013526154.1 hypothetical protein -
  HIBPF_RS06270 (HIBPF13000) - 1250089..1251009 (-) 921 WP_013526155.1 Mu-like prophage major head subunit gpT family protein -
  HIBPF_RS06275 (HIBPF_13040) - 1251009..1251944 (-) 936 WP_232501049.1 phage protease -
  HIBPF_RS06280 (HIBPF_13070) - 1251886..1252239 (-) 354 WP_013526157.1 phage virion morphogenesis protein -
  HIBPF_RS06285 (HIBPF13080) - 1252382..1253698 (-) 1317 WP_013526158.1 phage minor head protein -
  HIBPF_RS10400 (HIBPF_13110) - 1253682..1255303 (-) 1622 Protein_1242 DUF935 domain-containing protein -
  HIBPF_RS06295 (HIBPF13140) terL 1255383..1257032 (-) 1650 WP_013526159.1 phage terminase large subunit -
  HIBPF_RS06300 (HIBPF13170) - 1257182..1257682 (-) 501 WP_013526160.1 DUF1804 family protein -
  HIBPF_RS06305 (HIBPF13171) - 1257684..1257950 (-) 267 WP_005661915.1 hypothetical protein -
  HIBPF_RS06310 (HIBPF13172) - 1257950..1258207 (-) 258 WP_005684166.1 hypothetical protein -
  HIBPF_RS06315 (HIBPF13173) - 1258331..1258588 (-) 258 WP_013526161.1 DUF2681 domain-containing protein -
  HIBPF_RS06320 (HIBPF13180) - 1258588..1258878 (-) 291 WP_041174960.1 DUF2644 domain-containing protein -
  HIBPF_RS06325 (HIBPF13200) - 1259032..1259535 (-) 504 WP_013526163.1 glycoside hydrolase family 108 protein -
  HIBPF_RS06330 (HIBPF13220) - 1259616..1260044 (-) 429 WP_013526164.1 Mor transcription activator family protein -
  HIBPF_RS06335 (HIBPF13250) - 1260156..1260572 (-) 417 WP_013526165.1 type II toxin-antitoxin system HicB family antitoxin -
  HIBPF_RS06340 - 1260627..1260803 (-) 177 WP_041174961.1 type II toxin-antitoxin system HicA family toxin -
  HIBPF_RS06345 - 1260929..1261147 (-) 219 WP_005641522.1 hypothetical protein -
  HIBPF_RS06350 (HIBPF13290) - 1261158..1261799 (-) 642 WP_013526166.1 antA/AntB antirepressor family protein -
  HIBPF_RS06355 - 1262336..1262539 (-) 204 WP_006996626.1 KilA-N domain-containing protein -
  HIBPF_RS06360 (HIBPF13310) - 1262566..1262964 (-) 399 WP_013526167.1 gp16 family protein -
  HIBPF_RS06365 - 1263205..1263453 (-) 249 WP_006996624.1 hypothetical protein -
  HIBPF_RS06370 - 1263458..1263631 (-) 174 WP_006996623.1 hypothetical protein -
  HIBPF_RS10590 - 1263628..1263792 (-) 165 WP_171034544.1 hypothetical protein -
  HIBPF_RS06375 - 1263803..1264000 (-) 198 WP_006996621.1 ANR family transcriptional regulator -
  HIBPF_RS06380 (HIBPF13330) - 1264187..1264804 (-) 618 WP_013526168.1 DUF3164 family protein -
  HIBPF_RS06385 - 1264805..1264996 (-) 192 WP_005647090.1 HTH domain-containing protein -
  HIBPF_RS06390 (HIBPF13350) - 1265005..1265301 (-) 297 WP_013526169.1 hypothetical protein -
  HIBPF_RS06395 (HIBPF13370) - 1265313..1266193 (-) 881 Protein_1264 AAA family ATPase -
  HIBPF_RS06400 - 1266245..1266643 (-) 399 WP_032826358.1 hypothetical protein -
  HIBPF_RS06405 (HIBPF13420) - 1266654..1268639 (-) 1986 WP_013526171.1 Mu transposase C-terminal domain-containing protein -
  HIBPF_RS06410 - 1268683..1268961 (-) 279 WP_041174962.1 helix-turn-helix domain-containing protein -
  HIBPF_RS06415 (HIBPF13430) - 1269137..1269853 (+) 717 WP_013526172.1 helix-turn-helix transcriptional regulator -
  HIBPF_RS10490 - 1270234..1270401 (-) 168 WP_158305134.1 hypothetical protein -
  HIBPF_RS06420 (HIBPF_13440) rumB 1270446..1270880 (+) 435 Protein_1270 23S rRNA (uracil(747)-C(5))-methyltransferase -
  HIBPF_RS06425 (HIBPF13450) crp 1271245..1271919 (-) 675 WP_005647998.1 cAMP-activated global transcriptional regulator CRP Regulator
  HIBPF_RS06430 (HIBPF13460) - 1271904..1272155 (-) 252 WP_005647999.1 YheU family protein -
  HIBPF_RS06435 (HIBPF13470) slmA 1272177..1272833 (-) 657 WP_005648000.1 nucleoid occlusion factor SlmA -
  HIBPF_RS06440 (HIBPF13480) dut 1272837..1273292 (-) 456 WP_005631431.1 dUTP diphosphatase -
  HIBPF_RS06445 (HIBPF13490) coaBC 1273340..1274542 (-) 1203 WP_011272308.1 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC -
  HIBPF_RS06450 (HIBPF13500) radC 1274705..1275370 (+) 666 WP_013526173.1 RadC family protein -
  HIBPF_RS06455 (HIBPF13510) rpmB 1275584..1275820 (+) 237 WP_005542826.1 50S ribosomal protein L28 -
  HIBPF_RS06460 (HIBPF13520) rpmG 1275832..1276002 (+) 171 WP_005613503.1 50S ribosomal protein L33 -
  HIBPF_RS06465 (HIBPF13530) - 1276350..1277714 (+) 1365 WP_013526174.1 diaminobutyrate--2-oxoglutarate transaminase -
  HIBPF_RS06470 (HIBPF13560) ddc 1277905..1279440 (+) 1536 WP_013526175.1 L-2,4-diaminobutyrate decarboxylase -
  HIBPF_RS06475 (HIBPF13570) mutM 1279675..1280490 (+) 816 WP_013526176.1 DNA-formamidopyrimidine glycosylase -

Sequence


Protein


Download         Length: 224 a.a.        Molecular weight: 25151.85 Da        Isoelectric Point: 6.8375

>NTDB_id=39412 HIBPF_RS06425 WP_005647998.1 1271245..1271919(-) (crp) [Haemophilus influenzae F3031]
MSNELTEIDEVVTSSQEEATQRDPVLDWFLTHCHLHKYPAKSTLIHAGEDATTLYYVIKGSVMVSSKDDEGKEMILTYLG
AGQFFGEAGLFDEGSKRSAWVKTKTTCEIAEISYKKYRQLIQANPEILMFLTAQLARRLQNTSRQVTNLAFLDVAGRIAQ
TLMNLAKQPEAMTHPDGMQIKITRQEIGQMVGCSRETVGRIIKMLEDQNLIHAHGKTIVVYGAR

Nucleotide


Download         Length: 675 bp        

>NTDB_id=39412 HIBPF_RS06425 WP_005647998.1 1271245..1271919(-) (crp) [Haemophilus influenzae F3031]
ATGTCAAATGAATTAACCGAAATTGATGAAGTTGTAACCTCCTCTCAAGAAGAAGCAACTCAACGAGATCCCGTTTTAGA
TTGGTTTCTTACTCACTGCCATTTGCATAAATATCCTGCAAAATCAACTTTAATTCATGCTGGGGAAGATGCGACCACGC
TGTATTATGTAATTAAAGGTTCTGTAATGGTATCTTCAAAAGATGATGAAGGCAAAGAGATGATCCTCACTTACTTAGGA
GCAGGACAATTTTTTGGCGAAGCGGGATTATTTGATGAAGGTTCAAAACGATCAGCTTGGGTAAAAACAAAAACAACATG
TGAAATTGCTGAAATTTCCTATAAGAAATATCGCCAGTTGATTCAGGCAAACCCTGAAATCTTAATGTTTCTCACTGCAC
AATTGGCAAGACGTTTGCAAAATACATCACGTCAAGTCACGAATTTGGCATTTTTAGACGTCGCAGGTCGCATCGCTCAA
ACTTTAATGAACTTAGCTAAACAGCCTGAAGCAATGACGCATCCTGATGGTATGCAAATCAAAATTACACGCCAAGAAAT
AGGGCAAATGGTGGGTTGTTCACGAGAAACTGTGGGGCGCATTATTAAGATGTTGGAGGATCAGAATCTTATCCACGCTC
ATGGAAAAACAATCGTTGTATATGGCGCAAGATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q4QLV0

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  crp Haemophilus influenzae Rd KW20

100

100

1

  crp Vibrio cholerae strain A1552

75.49

91.071

0.687

  crp Acinetobacter baumannii D1279779

48.705

86.161

0.42


Multiple sequence alignment