Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   GCU76_RS13420 Genome accession   NZ_CP045425
Coordinates   2474802..2475176 (-) Length   124 a.a.
NCBI ID   WP_017696197.1    Uniprot ID   -
Organism   Bacillus subtilis strain JAAA     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2469802..2480176
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GCU76_RS13380 yqhG 2470141..2470935 (+) 795 WP_017696202.1 YqhG family protein -
  GCU76_RS13385 sinI 2471118..2471291 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  GCU76_RS13390 sinR 2471325..2471660 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  GCU76_RS13395 tasA 2471753..2472538 (-) 786 WP_041053490.1 biofilm matrix protein TasA -
  GCU76_RS13400 sipW 2472602..2473174 (-) 573 WP_080333421.1 signal peptidase I SipW -
  GCU76_RS13405 tapA 2473158..2473913 (-) 756 WP_017696199.1 amyloid fiber anchoring/assembly protein TapA -
  GCU76_RS13410 yqzG 2474184..2474510 (+) 327 WP_026113671.1 YqzG/YhdC family protein -
  GCU76_RS13415 spoIITA 2474552..2474731 (-) 180 WP_014480252.1 YqzE family protein -
  GCU76_RS13420 comGG 2474802..2475176 (-) 375 WP_017696197.1 ComG operon protein ComGG Machinery gene
  GCU76_RS13425 comGF 2475177..2475560 (-) 384 WP_017696196.1 ComG operon protein ComGF Machinery gene
  GCU76_RS13430 comGE 2475586..2475933 (-) 348 WP_017696195.1 competence type IV pilus minor pilin ComGE Machinery gene
  GCU76_RS13435 comGD 2475917..2476348 (-) 432 WP_017696194.1 competence type IV pilus minor pilin ComGD Machinery gene
  GCU76_RS13440 comGC 2476338..2476634 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  GCU76_RS13445 comGB 2476648..2477685 (-) 1038 WP_017696193.1 competence type IV pilus assembly protein ComGB Machinery gene
  GCU76_RS13450 comGA 2477672..2478742 (-) 1071 WP_017696192.1 competence protein ComGA Machinery gene
  GCU76_RS13455 - 2478953..2479099 (-) 147 WP_250619918.1 hypothetical protein -
  GCU76_RS13460 corA 2479152..2480105 (-) 954 WP_017696189.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14526.75 Da        Isoelectric Point: 9.7778

>NTDB_id=393990 GCU76_RS13420 WP_017696197.1 2474802..2475176(-) (comGG) [Bacillus subtilis strain JAAA]
MYRTRGFIYPAVLFVSALVLLIVNFASAQYISRCMFEKETKELYIGENLLQNGTLLSIRHVLEKRKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=393990 GCU76_RS13420 WP_017696197.1 2474802..2475176(-) (comGG) [Bacillus subtilis strain JAAA]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTACTGTTAATCGTGAACTTTGCTTC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGTA
CGCTTCTTTCGATTCGGCACGTTCTAGAGAAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGATCAAAAACAGAAAAAGCTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

95.161

100

0.952

Multiple sequence alignment