Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   GCU76_RS13385 Genome accession   NZ_CP045425
Coordinates   2471118..2471291 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain JAAA     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2466118..2476291
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  GCU76_RS13370 gcvT 2466918..2468006 (-) 1089 WP_017696204.1 glycine cleavage system aminomethyltransferase GcvT -
  GCU76_RS13375 hepAA 2468447..2470120 (+) 1674 WP_017696203.1 SNF2-related protein -
  GCU76_RS13380 yqhG 2470141..2470935 (+) 795 WP_017696202.1 YqhG family protein -
  GCU76_RS13385 sinI 2471118..2471291 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  GCU76_RS13390 sinR 2471325..2471660 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  GCU76_RS13395 tasA 2471753..2472538 (-) 786 WP_041053490.1 biofilm matrix protein TasA -
  GCU76_RS13400 sipW 2472602..2473174 (-) 573 WP_080333421.1 signal peptidase I SipW -
  GCU76_RS13405 tapA 2473158..2473913 (-) 756 WP_017696199.1 amyloid fiber anchoring/assembly protein TapA -
  GCU76_RS13410 yqzG 2474184..2474510 (+) 327 WP_026113671.1 YqzG/YhdC family protein -
  GCU76_RS13415 spoIITA 2474552..2474731 (-) 180 WP_014480252.1 YqzE family protein -
  GCU76_RS13420 comGG 2474802..2475176 (-) 375 WP_017696197.1 ComG operon protein ComGG Machinery gene
  GCU76_RS13425 comGF 2475177..2475560 (-) 384 WP_017696196.1 ComG operon protein ComGF Machinery gene
  GCU76_RS13430 comGE 2475586..2475933 (-) 348 WP_017696195.1 competence type IV pilus minor pilin ComGE Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=393988 GCU76_RS13385 WP_003230187.1 2471118..2471291(+) (sinI) [Bacillus subtilis strain JAAA]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=393988 GCU76_RS13385 WP_003230187.1 2471118..2471291(+) (sinI) [Bacillus subtilis strain JAAA]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment