Detailed information NTG0392471

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: F9286_RS11800
• Genome accession: NZ_CP045186
• Coordinates: 2440326..2440763 (-)
• Length: 145 a.a.
• NCBI ID: WP_007612572.1
• Uniprot ID: -
• Organism: Bacillus velezensis strain FJAT-52631
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2435326..2445763

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
F9286_RS11750 (F9286_11750)	sinI	2435709..2435882 (+)	174	WP_032874029.1	anti-repressor SinI	Regulator
F9286_RS11755 (F9286_11755)	sinR	2435916..2436251 (+)	336	WP_003153104.1	transcriptional regulator SinR	Regulator
F9286_RS11760 (F9286_11760)	tasA	2436299..2437084 (-)	786	WP_032874027.1	biofilm matrix protein TasA	-
F9286_RS11765 (F9286_11765)	sipW	2437149..2437733 (-)	585	WP_032874025.1	signal peptidase I SipW	-
F9286_RS11770 (F9286_11770)	tapA	2437705..2438376 (-)	672	WP_032874023.1	amyloid fiber anchoring/assembly protein TapA	-
F9286_RS11775 (F9286_11775)	-	2438635..2438964 (+)	330	WP_032874021.1	DUF3889 domain-containing protein	-
F9286_RS11780 (F9286_11780)	-	2439005..2439184 (-)	180	WP_022552966.1	YqzE family protein	-
F9286_RS11785 (F9286_11785)	comGG	2439241..2439618 (-)	378	WP_032874019.1	competence type IV pilus minor pilin ComGG	Machinery gene
F9286_RS11790 (F9286_11790)	comGF	2439619..2440083 (-)	465	WP_223813077.1	competence type IV pilus minor pilin ComGF	-
F9286_RS11795 (F9286_11795)	comGE	2440028..2440342 (-)	315	WP_032874016.1	competence type IV pilus minor pilin ComGE	Machinery gene
F9286_RS11800 (F9286_11800)	comGD	2440326..2440763 (-)	438	WP_007612572.1	competence type IV pilus minor pilin ComGD	Machinery gene
F9286_RS11805 (F9286_11805)	comGC	2440753..2441061 (-)	309	WP_003153087.1	competence type IV pilus major pilin ComGC	Machinery gene
F9286_RS11810 (F9286_11810)	comGB	2441066..2442103 (-)	1038	WP_032874014.1	competence type IV pilus assembly protein ComGB	Machinery gene
F9286_RS11815 (F9286_11815)	comGA	2442090..2443160 (-)	1071	WP_003153083.1	competence type IV pilus ATPase ComGA	Machinery gene
F9286_RS11820 (F9286_11820)	-	2443357..2444307 (-)	951	WP_032874012.1	magnesium transporter CorA family protein	-
F9286_RS11825 (F9286_11825)	-	2444453..2445754 (+)	1302	WP_032874010.1	hemolysin family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16254.76 Da
• Isoelectric Point: 10.1850

>NTDB_id=392471 F9286_RS11800 WP_007612572.1 2440326..2440763(-) (comGD) [Bacillus velezensis strain FJAT-52631]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide

• Length: 438 bp

>NTDB_id=392471 F9286_RS11800 WP_007612572.1 2440326..2440763(-) (comGD) [Bacillus velezensis strain FJAT-52631]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCATATTACACTTGTAACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATAACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	55.479	100	0.559