Detailed information    

insolico Bioinformatically predicted

Overview

Name   comC/blpC   Type   Regulator
Locus tag   FSA40_RS08875 Genome accession   NZ_CP044493
Coordinates   1749689..1749829 (+) Length   46 a.a.
NCBI ID   WP_002270250.1    Uniprot ID   Q9APK7
Organism   Streptococcus mutans strain MD     
Function   binding to ComD; induce autophosphorylation of ComD; regulation of comX expression (predicted from homology)   
Competence regulation

Genomic Context

Location: 1744689..1754829
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FSA40_RS08825 (FSA40_1769) - 1744753..1744965 (-) 213 WP_002264173.1 Blp family class II bacteriocin -
  FSA40_RS08835 (FSA40_1770) - 1745370..1745534 (-) 165 WP_002265308.1 hypothetical protein -
  FSA40_RS10485 - 1745974..1746186 (+) 213 Protein_1649 IS3 family transposase -
  FSA40_RS08850 (FSA40_1772) - 1746309..1746713 (-) 405 WP_002263912.1 hypothetical protein -
  FSA40_RS08855 (FSA40_1773) - 1746860..1747279 (-) 420 WP_151416432.1 hypothetical protein -
  FSA40_RS08865 (FSA40_1775) - 1748660..1749061 (-) 402 WP_002310604.1 hypothetical protein -
  FSA40_RS08870 (FSA40_1776) cipB 1749192..1749422 (-) 231 WP_002265368.1 Blp family class II bacteriocin Regulator
  FSA40_RS08875 (FSA40_1777) comC/blpC 1749689..1749829 (+) 141 WP_002270250.1 ComC/BlpC family leader-containing pheromone/bacteriocin Regulator
  FSA40_RS08880 (FSA40_1778) comD/blpH 1749971..1751296 (-) 1326 WP_002292008.1 GHKL domain-containing protein Regulator
  FSA40_RS08885 (FSA40_1779) comE/blpR 1751293..1752045 (-) 753 WP_151416433.1 response regulator transcription factor Regulator
  FSA40_RS08890 (FSA40_1780) - 1752517..1753155 (-) 639 WP_002265117.1 VTT domain-containing protein -
  FSA40_RS08895 (FSA40_1781) - 1753202..1753828 (-) 627 WP_002265453.1 hypothetical protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5195.02 Da        Isoelectric Point: 10.4929

>NTDB_id=390389 FSA40_RS08875 WP_002270250.1 1749689..1749829(+) (comC/blpC) [Streptococcus mutans strain MD]
MKKTPSLKNDFKEIKTDELEIIIGGSGSLSTFFRLFNRSFTQALGK

Nucleotide


Download         Length: 141 bp        

>NTDB_id=390389 FSA40_RS08875 WP_002270250.1 1749689..1749829(+) (comC/blpC) [Streptococcus mutans strain MD]
ATGAAAAAAACACCATCATTAAAAAATGACTTTAAAGAAATTAAGACTGATGAATTAGAGATTATCATTGGCGGAAGCGG
AAGCCTATCAACATTTTTCCGGCTGTTTAACAGAAGTTTTACACAAGCTTTGGGAAAATAA

Domains

Predicted by InterproScan.

COMC family (ComC)

(1-32)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q9APK7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comC/blpC Streptococcus mutans UA159

97.826

100

0.978

Multiple sequence alignment