Detailed information    

insolico Bioinformatically predicted

Overview


Name   comC/blpC   Type   Regulator
Locus tag   FSA31_RS08640 Genome accession   NZ_CP044492
Coordinates   1726310..1726450 (+) Length   46 a.a.
NCBI ID   WP_002270250.1    Uniprot ID   Q9APK7
Organism   Streptococcus mutans strain T8     
Function   binding to ComD; induce autophosphorylation of ComD; regulation of comX expression (predicted from homology)   
Competence regulation

Genomic Context


Location: 1721310..1731450
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FSA31_RS08610 (FSA31_1705) - 1722337..1723279 (+) 943 Protein_1608 HlyD family efflux transporter periplasmic adaptor subunit -
  FSA31_RS08615 (FSA31_1706) - 1723540..1723683 (-) 144 WP_002263740.1 hypothetical protein -
  FSA31_RS08625 (FSA31_1707) - 1723975..1724997 (-) 1023 WP_002284748.1 thioredoxin family protein -
  FSA31_RS08630 (FSA31_1708) - 1725478..1725666 (-) 189 WP_002284747.1 Blp family class II bacteriocin -
  FSA31_RS08635 (FSA31_1709) - 1725834..1726043 (-) 210 WP_002268232.1 Blp family class II bacteriocin -
  FSA31_RS08640 (FSA31_1710) comC/blpC 1726310..1726450 (+) 141 WP_002270250.1 ComC/BlpC family leader-containing pheromone/bacteriocin Regulator
  FSA31_RS08645 (FSA31_1711) comD/blpH 1726592..1727917 (-) 1326 WP_002284746.1 GHKL domain-containing protein Regulator
  FSA31_RS08650 (FSA31_1712) comE/blpR 1727914..1728666 (-) 753 WP_002284745.1 response regulator transcription factor Regulator
  FSA31_RS08655 (FSA31_1713) - 1729131..1729769 (-) 639 WP_002262115.1 VTT domain-containing protein -
  FSA31_RS08660 (FSA31_1714) - 1729817..1730443 (-) 627 WP_002268642.1 hypothetical protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5195.02 Da        Isoelectric Point: 10.4929

>NTDB_id=390317 FSA31_RS08640 WP_002270250.1 1726310..1726450(+) (comC/blpC) [Streptococcus mutans strain T8]
MKKTPSLKNDFKEIKTDELEIIIGGSGSLSTFFRLFNRSFTQALGK

Nucleotide


Download         Length: 141 bp        

>NTDB_id=390317 FSA31_RS08640 WP_002270250.1 1726310..1726450(+) (comC/blpC) [Streptococcus mutans strain T8]
ATGAAAAAAACACCATCATTAAAAAATGACTTTAAAGAAATTAAGACTGATGAATTAGAGATTATCATTGGCGGAAGCGG
AAGCCTATCAACATTTTTCCGGCTGTTTAACAGAAGTTTTACACAAGCTTTGGGAAAATAA

Domains


Predicted by InterproScan.

(1-32)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q9APK7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comC/blpC Streptococcus mutans UA159

97.826

100

0.978


Multiple sequence alignment