Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | BACIH_RS14550 | Genome accession | NZ_CP044360 |
| Coordinates | 2946836..2946976 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus amyloliquefaciens strain V167 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2941836..2951976
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BACIH_RS14525 (BACIH_2959) | - | 2942180..2942563 (-) | 384 | WP_012118312.1 | hotdog fold thioesterase | - |
| BACIH_RS14530 (BACIH_2960) | comA | 2942585..2943229 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| BACIH_RS14535 (BACIH_2961) | comP | 2943310..2945610 (-) | 2301 | WP_077411086.1 | histidine kinase | Regulator |
| BACIH_RS14540 (BACIH_2962) | comX | 2945624..2945797 (-) | 174 | WP_012118314.1 | competence pheromone ComX | - |
| BACIH_RS14545 (BACIH_2963) | - | 2945812..2946627 (-) | 816 | WP_191973487.1 | polyprenyl synthetase family protein | - |
| BACIH_RS14550 (BACIH_2964) | degQ | 2946836..2946976 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| BACIH_RS14560 (BACIH_2966) | - | 2947441..2947782 (+) | 342 | WP_012118316.1 | hypothetical protein | - |
| BACIH_RS14565 (BACIH_2967) | - | 2947789..2949012 (-) | 1224 | WP_007408678.1 | EAL and HDOD domain-containing protein | - |
| BACIH_RS14570 (BACIH_2968) | - | 2949142..2950608 (-) | 1467 | WP_014418767.1 | nicotinate phosphoribosyltransferase | - |
| BACIH_RS14575 (BACIH_2969) | - | 2950626..2951177 (-) | 552 | WP_003152033.1 | cysteine hydrolase family protein | - |
| BACIH_RS14580 (BACIH_2970) | - | 2951274..2951672 (-) | 399 | WP_003152031.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=389691 BACIH_RS14550 WP_003152043.1 2946836..2946976(-) (degQ) [Bacillus amyloliquefaciens strain V167]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=389691 BACIH_RS14550 WP_003152043.1 2946836..2946976(-) (degQ) [Bacillus amyloliquefaciens strain V167]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |