Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   BACIH_RS14550 Genome accession   NZ_CP044360
Coordinates   2946836..2946976 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain V167     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2941836..2951976
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BACIH_RS14525 (BACIH_2959) - 2942180..2942563 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  BACIH_RS14530 (BACIH_2960) comA 2942585..2943229 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  BACIH_RS14535 (BACIH_2961) comP 2943310..2945610 (-) 2301 WP_077411086.1 histidine kinase Regulator
  BACIH_RS14540 (BACIH_2962) comX 2945624..2945797 (-) 174 WP_012118314.1 competence pheromone ComX -
  BACIH_RS14545 (BACIH_2963) - 2945812..2946627 (-) 816 WP_191973487.1 polyprenyl synthetase family protein -
  BACIH_RS14550 (BACIH_2964) degQ 2946836..2946976 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  BACIH_RS14560 (BACIH_2966) - 2947441..2947782 (+) 342 WP_012118316.1 hypothetical protein -
  BACIH_RS14565 (BACIH_2967) - 2947789..2949012 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  BACIH_RS14570 (BACIH_2968) - 2949142..2950608 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  BACIH_RS14575 (BACIH_2969) - 2950626..2951177 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  BACIH_RS14580 (BACIH_2970) - 2951274..2951672 (-) 399 WP_003152031.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=389691 BACIH_RS14550 WP_003152043.1 2946836..2946976(-) (degQ) [Bacillus amyloliquefaciens strain V167]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=389691 BACIH_RS14550 WP_003152043.1 2946836..2946976(-) (degQ) [Bacillus amyloliquefaciens strain V167]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891


Multiple sequence alignment