Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   BACIH_RS11560 Genome accession   NZ_CP044360
Coordinates   2377838..2378215 (-) Length   125 a.a.
NCBI ID   WP_012117980.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain V167     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2372838..2383215
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BACIH_RS11520 (BACIH_2351) - 2373336..2374130 (+) 795 WP_012117976.1 YqhG family protein -
  BACIH_RS11525 (BACIH_2352) sinI 2374307..2374480 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  BACIH_RS11530 (BACIH_2353) sinR 2374514..2374849 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BACIH_RS11535 (BACIH_2354) tasA 2374897..2375682 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  BACIH_RS11540 (BACIH_2355) sipW 2375747..2376331 (-) 585 WP_012117977.1 signal peptidase I SipW -
  BACIH_RS11545 (BACIH_2356) tapA 2376303..2376974 (-) 672 WP_012117978.1 amyloid fiber anchoring/assembly protein TapA -
  BACIH_RS11550 (BACIH_2357) - 2377233..2377562 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  BACIH_RS11555 (BACIH_2358) - 2377602..2377781 (-) 180 WP_003153093.1 YqzE family protein -
  BACIH_RS11560 (BACIH_2359) comGG 2377838..2378215 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  BACIH_RS11565 (BACIH_2360) comGF 2378216..2378716 (-) 501 WP_012117981.1 competence type IV pilus minor pilin ComGF -
  BACIH_RS11570 (BACIH_2361) comGE 2378625..2378939 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  BACIH_RS11575 (BACIH_2362) comGD 2378923..2379360 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  BACIH_RS11580 (BACIH_2363) comGC 2379350..2379658 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  BACIH_RS11585 (BACIH_2364) comGB 2379663..2380700 (-) 1038 WP_012117984.1 competence type IV pilus assembly protein ComGB Machinery gene
  BACIH_RS11590 (BACIH_2365) comGA 2380687..2381757 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  BACIH_RS11595 (BACIH_2366) - 2381954..2382904 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14195.14 Da        Isoelectric Point: 9.7165

>NTDB_id=389672 BACIH_RS11560 WP_012117980.1 2377838..2378215(-) (comGG) [Bacillus amyloliquefaciens strain V167]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGVLLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=389672 BACIH_RS11560 WP_012117980.1 2377838..2378215(-) (comGG) [Bacillus amyloliquefaciens strain V167]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
TGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512

Multiple sequence alignment