Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BACIH_RS11525 | Genome accession | NZ_CP044360 |
| Coordinates | 2374307..2374480 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus amyloliquefaciens strain V167 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2369307..2379480
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BACIH_RS11510 (BACIH_2349) | gcvT | 2370120..2371220 (-) | 1101 | WP_012117974.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| BACIH_RS11515 (BACIH_2350) | - | 2371644..2373314 (+) | 1671 | WP_012117975.1 | DEAD/DEAH box helicase | - |
| BACIH_RS11520 (BACIH_2351) | - | 2373336..2374130 (+) | 795 | WP_012117976.1 | YqhG family protein | - |
| BACIH_RS11525 (BACIH_2352) | sinI | 2374307..2374480 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| BACIH_RS11530 (BACIH_2353) | sinR | 2374514..2374849 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| BACIH_RS11535 (BACIH_2354) | tasA | 2374897..2375682 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| BACIH_RS11540 (BACIH_2355) | sipW | 2375747..2376331 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| BACIH_RS11545 (BACIH_2356) | tapA | 2376303..2376974 (-) | 672 | WP_012117978.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BACIH_RS11550 (BACIH_2357) | - | 2377233..2377562 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| BACIH_RS11555 (BACIH_2358) | - | 2377602..2377781 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| BACIH_RS11560 (BACIH_2359) | comGG | 2377838..2378215 (-) | 378 | WP_012117980.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| BACIH_RS11565 (BACIH_2360) | comGF | 2378216..2378716 (-) | 501 | WP_012117981.1 | competence type IV pilus minor pilin ComGF | - |
| BACIH_RS11570 (BACIH_2361) | comGE | 2378625..2378939 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| BACIH_RS11575 (BACIH_2362) | comGD | 2378923..2379360 (-) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=389670 BACIH_RS11525 WP_003153105.1 2374307..2374480(+) (sinI) [Bacillus amyloliquefaciens strain V167]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=389670 BACIH_RS11525 WP_003153105.1 2374307..2374480(+) (sinI) [Bacillus amyloliquefaciens strain V167]
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |