Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   BACIH_RS11525 Genome accession   NZ_CP044360
Coordinates   2374307..2374480 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus amyloliquefaciens strain V167     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2369307..2379480
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BACIH_RS11510 (BACIH_2349) gcvT 2370120..2371220 (-) 1101 WP_012117974.1 glycine cleavage system aminomethyltransferase GcvT -
  BACIH_RS11515 (BACIH_2350) - 2371644..2373314 (+) 1671 WP_012117975.1 DEAD/DEAH box helicase -
  BACIH_RS11520 (BACIH_2351) - 2373336..2374130 (+) 795 WP_012117976.1 YqhG family protein -
  BACIH_RS11525 (BACIH_2352) sinI 2374307..2374480 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  BACIH_RS11530 (BACIH_2353) sinR 2374514..2374849 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BACIH_RS11535 (BACIH_2354) tasA 2374897..2375682 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  BACIH_RS11540 (BACIH_2355) sipW 2375747..2376331 (-) 585 WP_012117977.1 signal peptidase I SipW -
  BACIH_RS11545 (BACIH_2356) tapA 2376303..2376974 (-) 672 WP_012117978.1 amyloid fiber anchoring/assembly protein TapA -
  BACIH_RS11550 (BACIH_2357) - 2377233..2377562 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  BACIH_RS11555 (BACIH_2358) - 2377602..2377781 (-) 180 WP_003153093.1 YqzE family protein -
  BACIH_RS11560 (BACIH_2359) comGG 2377838..2378215 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  BACIH_RS11565 (BACIH_2360) comGF 2378216..2378716 (-) 501 WP_012117981.1 competence type IV pilus minor pilin ComGF -
  BACIH_RS11570 (BACIH_2361) comGE 2378625..2378939 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  BACIH_RS11575 (BACIH_2362) comGD 2378923..2379360 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=389670 BACIH_RS11525 WP_003153105.1 2374307..2374480(+) (sinI) [Bacillus amyloliquefaciens strain V167]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=389670 BACIH_RS11525 WP_003153105.1 2374307..2374480(+) (sinI) [Bacillus amyloliquefaciens strain V167]
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702


Multiple sequence alignment