Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   F0M22_RS09625 Genome accession   NZ_CP044236
Coordinates   1967212..1967697 (-) Length   161 a.a.
NCBI ID   WP_242755144.1    Uniprot ID   -
Organism   Lacticaseibacillus paracasei strain WX322     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1931098..1974471 1967212..1967697 within 0


Gene organization within MGE regions


Location: 1931098..1974471
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  F0M22_RS09400 - 1931098..1931949 (+) 852 WP_016382265.1 DNA/RNA non-specific endonuclease -
  F0M22_RS09405 - 1932030..1932560 (+) 531 WP_003569908.1 hypothetical protein -
  F0M22_RS09410 - 1932744..1933031 (+) 288 WP_003564892.1 putative quinol monooxygenase -
  F0M22_RS09415 - 1933133..1933912 (+) 780 WP_003584221.1 DUF1828 domain-containing protein -
  F0M22_RS16265 - 1934271..1934345 (-) 75 Protein_1842 glucose-6-phosphate isomerase -
  F0M22_RS09420 - 1934542..1935717 (-) 1176 WP_242755068.1 GH25 family lysozyme -
  F0M22_RS09425 - 1935714..1935941 (-) 228 WP_242755070.1 hypothetical protein -
  F0M22_RS09430 - 1935954..1936400 (-) 447 WP_242755073.1 phage holin -
  F0M22_RS09435 - 1936393..1936602 (-) 210 WP_242755076.1 hypothetical protein -
  F0M22_RS09440 - 1936571..1936969 (-) 399 WP_242755078.1 hypothetical protein -
  F0M22_RS16205 - 1937000..1937131 (-) 132 WP_341275996.1 XkdX family protein -
  F0M22_RS09450 - 1937124..1937414 (-) 291 WP_242755080.1 hypothetical protein -
  F0M22_RS09455 - 1937430..1939946 (-) 2517 WP_242755082.1 phage tail protein -
  F0M22_RS09460 - 1939947..1941866 (-) 1920 WP_242755084.1 distal tail protein Dit -
  F0M22_RS09465 - 1941867..1946729 (-) 4863 WP_242755094.1 phage tail tape measure protein -
  F0M22_RS09470 - 1946852..1947265 (-) 414 WP_049179703.1 hypothetical protein -
  F0M22_RS09475 - 1947336..1947521 (-) 186 WP_242755932.1 Ig-like domain-containing protein -
  F0M22_RS09480 - 1947578..1948186 (-) 609 WP_242755096.1 major tail protein -
  F0M22_RS09485 - 1948220..1948606 (-) 387 WP_242755098.1 phage tail protein -
  F0M22_RS09490 - 1948606..1948992 (-) 387 WP_242755100.1 HK97-gp10 family putative phage morphogenesis protein -
  F0M22_RS09495 - 1948992..1949321 (-) 330 WP_238065333.1 head-tail adaptor protein -
  F0M22_RS09500 - 1949311..1949670 (-) 360 WP_242755102.1 head-tail connector protein -
  F0M22_RS09505 - 1949681..1949920 (-) 240 WP_101512065.1 Ig-like domain-containing protein -
  F0M22_RS09510 - 1949938..1951140 (-) 1203 WP_242755105.1 phage major capsid protein -
  F0M22_RS09515 - 1951181..1951810 (-) 630 WP_242755114.1 HK97 family phage prohead protease -
  F0M22_RS09520 - 1951764..1952234 (-) 471 Protein_1863 phage portal protein -
  F0M22_RS09525 - 1952256..1953176 (-) 921 WP_242755117.1 IS30 family transposase -
  F0M22_RS09530 - 1953287..1954072 (-) 786 Protein_1865 phage portal protein -
  F0M22_RS09535 - 1954078..1954269 (-) 192 WP_003661399.1 hypothetical protein -
  F0M22_RS09540 - 1954281..1955993 (-) 1713 WP_242755120.1 terminase TerL endonuclease subunit -
  F0M22_RS09545 - 1956015..1956470 (-) 456 WP_003661401.1 P27 family phage terminase small subunit -
  F0M22_RS09550 - 1956670..1957464 (-) 795 WP_242755122.1 HNH endonuclease -
  F0M22_RS09555 - 1957454..1957705 (-) 252 Protein_1870 hypothetical protein -
  F0M22_RS16270 - 1957739..1958062 (-) 324 WP_341276002.1 hypothetical protein -
  F0M22_RS09560 - 1958084..1958161 (-) 78 Protein_1872 ribonucleoside-diphosphate reductase -
  F0M22_RS09565 - 1958165..1958695 (-) 531 WP_242755124.1 NUMOD4 domain-containing protein -
  F0M22_RS09570 - 1958682..1959899 (-) 1218 WP_242755126.1 GcrA family cell cycle regulator -
  F0M22_RS09575 - 1960505..1961101 (-) 597 WP_242755128.1 hypothetical protein -
  F0M22_RS09580 - 1961076..1962002 (-) 927 WP_242755130.1 Kiwa anti-phage protein KwaB-like domain-containing protein -
  F0M22_RS09585 - 1962684..1963136 (-) 453 WP_016373304.1 ArpU family phage packaging/lysis transcriptional regulator -
  F0M22_RS09590 - 1963531..1963722 (-) 192 WP_242755132.1 helix-turn-helix transcriptional regulator -
  F0M22_RS09595 - 1963789..1964073 (-) 285 WP_027111582.1 hypothetical protein -
  F0M22_RS09600 - 1964070..1964246 (-) 177 WP_172598669.1 hypothetical protein -
  F0M22_RS09605 - 1964261..1964737 (-) 477 WP_242755135.1 alcohol dehydrogenase -
  F0M22_RS09610 - 1964753..1965097 (-) 345 WP_242755137.1 hypothetical protein -
  F0M22_RS09615 - 1965099..1966361 (-) 1263 WP_242755140.1 DnaB helicase C-terminal domain-containing protein -
  F0M22_RS09620 - 1966358..1967185 (-) 828 WP_242755142.1 helix-turn-helix domain-containing protein -
  F0M22_RS09625 ssb 1967212..1967697 (-) 486 WP_242755144.1 single-stranded DNA-binding protein Machinery gene
  F0M22_RS09630 - 1967712..1968500 (-) 789 WP_242755146.1 tyrosine-type recombinase/integrase -
  F0M22_RS09635 - 1968687..1968926 (-) 240 WP_081528638.1 hypothetical protein -
  F0M22_RS09640 - 1969073..1969240 (-) 168 WP_242755148.1 hypothetical protein -
  F0M22_RS09645 - 1969322..1969645 (-) 324 WP_071252641.1 DUF771 domain-containing protein -
  F0M22_RS09650 - 1969710..1970204 (+) 495 WP_242755150.1 hypothetical protein -
  F0M22_RS09655 - 1970167..1970382 (-) 216 WP_194853331.1 hypothetical protein -
  F0M22_RS09660 - 1970383..1971198 (-) 816 WP_242755153.1 ORF6N domain-containing protein -
  F0M22_RS09665 - 1971233..1971472 (-) 240 WP_003660445.1 pathogenicity island protein -
  F0M22_RS09670 - 1971610..1972443 (+) 834 WP_273646930.1 S24 family peptidase -
  F0M22_RS09675 - 1972496..1973128 (+) 633 WP_242755156.1 hypothetical protein -
  F0M22_RS09680 - 1973302..1974471 (+) 1170 WP_242755159.1 site-specific integrase -

Sequence

Protein


Download         Length: 161 a.a.        Molecular weight: 17611.47 Da        Isoelectric Point: 6.7221

>NTDB_id=389079 F0M22_RS09625 WP_242755144.1 1967212..1967697(-) (ssb) [Lacticaseibacillus paracasei strain WX322]
MINSVALTGRLTRNVDVRYTQSGTAVGSFTIAVDRQFRSANGEHEADFINCVIWRKSAENLANFVKKGSLVGVEGRIQTR
TYDNAQGQKVFITEVVVESFALLESRQASQNGTESQHATNRTATVISDGSHKKPKTSLSDSTDQFANNGKPIDISDDDLP
F

Nucleotide


Download         Length: 486 bp        

>NTDB_id=389079 F0M22_RS09625 WP_242755144.1 1967212..1967697(-) (ssb) [Lacticaseibacillus paracasei strain WX322]
ATGATTAATTCAGTTGCATTAACAGGCAGATTAACTAGAAATGTTGACGTCAGGTACACGCAAAGCGGAACTGCTGTCGG
GTCTTTCACGATTGCCGTTGACCGGCAATTCCGCAGTGCAAACGGAGAACATGAAGCTGACTTCATTAACTGTGTCATCT
GGCGTAAGTCCGCCGAGAATTTGGCAAATTTCGTCAAAAAAGGATCCTTGGTTGGAGTTGAAGGCCGTATTCAAACACGT
ACGTATGACAACGCTCAAGGACAAAAAGTGTTTATTACGGAGGTTGTAGTTGAGAGTTTTGCTCTGCTTGAGTCACGACA
AGCGTCACAGAACGGCACTGAATCTCAACACGCGACCAATAGGACAGCAACAGTAATCTCGGACGGGAGTCATAAAAAGC
CTAAAACTTCATTAAGTGATTCCACAGATCAATTTGCCAACAACGGTAAGCCAATTGATATTAGCGATGACGATCTTCCA
TTCTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-102)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

58.824

100

0.621
  ssbA Bacillus subtilis subsp. subtilis str. 168

48.837

100

0.522
  ssb Vibrio cholerae strain A1552

33.908

100

0.366

Multiple sequence alignment