Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   F5989_RS07770 Genome accession   NZ_CP044221
Coordinates   1562336..1562566 (+) Length   76 a.a.
NCBI ID   WP_002265368.1    Uniprot ID   Q8DS95
Organism   Streptococcus mutans strain NCH105     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 1557336..1567566
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  F5989_RS07745 (F5989_07885) - 1557929..1558555 (+) 627 WP_002266898.1 hypothetical protein -
  F5989_RS07750 (F5989_07890) - 1558603..1559241 (+) 639 WP_002262115.1 VTT domain-containing protein -
  F5989_RS07755 (F5989_07895) comE/blpR 1559713..1560465 (+) 753 WP_002262114.1 response regulator transcription factor Regulator
  F5989_RS07760 (F5989_07900) comD/blpH 1560462..1561787 (+) 1326 WP_002289696.1 sensor histidine kinase Regulator
  F5989_RS07765 (F5989_07905) comC/blpC 1561929..1562069 (-) 141 WP_002267610.1 ComC/BlpC family leader-containing pheromone/bacteriocin Regulator
  F5989_RS07770 (F5989_07910) cipB 1562336..1562566 (+) 231 WP_002265368.1 Blp family class II bacteriocin Regulator
  F5989_RS07775 (F5989_07915) - 1562697..1563098 (+) 402 WP_002310604.1 hypothetical protein -
  F5989_RS07785 (F5989_07925) - 1564479..1564898 (+) 420 WP_002263913.1 hypothetical protein -
  F5989_RS07790 (F5989_07930) - 1565045..1565449 (+) 405 WP_002263912.1 hypothetical protein -
  F5989_RS10295 - 1565572..1565784 (-) 213 Protein_1468 IS3 family transposase -
  F5989_RS07795 (F5989_07945) - 1566224..1566388 (+) 165 WP_002265308.1 hypothetical protein -
  F5989_RS07805 (F5989_07955) - 1566793..1567005 (+) 213 WP_002263744.1 Blp family class II bacteriocin -
  F5989_RS07810 (F5989_07960) - 1567169..1567357 (+) 189 WP_002263743.1 Blp family class II bacteriocin -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 7262.08 Da        Isoelectric Point: 3.7781

>NTDB_id=388867 F5989_RS07770 WP_002265368.1 1562336..1562566(+) (cipB) [Streptococcus mutans strain NCH105]
MNTQAFEQFNVMDNEALSAVEGGGRGWNCAAGIALGAGQGYMATAGGTAFLGPYAIGTGAFGAIAGGIGGALNSCG

Nucleotide


Download         Length: 231 bp        

>NTDB_id=388867 F5989_RS07770 WP_002265368.1 1562336..1562566(+) (cipB) [Streptococcus mutans strain NCH105]
ATGAATACACAAGCATTTGAACAATTTAACGTAATGGATAATGAAGCACTTTCAGCTGTTGAAGGTGGGGGCCGCGGATG
GAATTGTGCAGCAGGTATTGCTCTAGGTGCTGGGCAAGGTTATATGGCTACTGCAGGCGGTACAGCATTTCTTGGTCCAT
ATGCTATTGGCACTGGTGCCTTTGGGGCTATTGCTGGAGGAATCGGAGGAGCTCTTAATTCCTGTGGTTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q8DS95

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

100

100

1


Multiple sequence alignment