Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   F5K02_RS16170 Genome accession   NZ_CP044132
Coordinates   3257008..3257148 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain ZKY01     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3252008..3262148
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  F5K02_RS16145 (F5K02_16245) - 3252335..3252718 (-) 384 WP_007408674.1 hotdog fold thioesterase -
  F5K02_RS16150 (F5K02_16250) comA 3252740..3253384 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  F5K02_RS16155 (F5K02_16255) comP 3253465..3255771 (-) 2307 WP_094032817.1 sensor histidine kinase Regulator
  F5K02_RS16160 (F5K02_16260) comX 3255790..3255966 (-) 177 WP_015240484.1 competence pheromone ComX -
  F5K02_RS16165 (F5K02_16265) - 3255981..3256856 (-) 876 WP_025285191.1 polyprenyl synthetase family protein -
  F5K02_RS16170 (F5K02_16270) degQ 3257008..3257148 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  F5K02_RS16175 (F5K02_16280) - 3257611..3257952 (+) 342 WP_007408677.1 hypothetical protein -
  F5K02_RS16180 (F5K02_16285) - 3257959..3259182 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  F5K02_RS16185 (F5K02_16290) - 3259312..3260778 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  F5K02_RS16190 (F5K02_16295) - 3260796..3261347 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  F5K02_RS16195 (F5K02_16300) - 3261444..3261842 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=388120 F5K02_RS16170 WP_003152043.1 3257008..3257148(-) (degQ) [Bacillus amyloliquefaciens strain ZKY01]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=388120 F5K02_RS16170 WP_003152043.1 3257008..3257148(-) (degQ) [Bacillus amyloliquefaciens strain ZKY01]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment