Detailed information    

insolico Bioinformatically predicted

Overview


Name   crp   Type   Regulator
Locus tag   F1538_RS05100 Genome accession   NZ_CP043771
Coordinates   1026173..1026847 (-) Length   224 a.a.
NCBI ID   WP_005647998.1    Uniprot ID   Q4QLV0
Organism   Haemophilus influenzae biotype aegyptius strain HE15/F3028     
Function   promote expression of competence genes (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1004206..1037633 1026173..1026847 within 0


Gene organization within MGE regions


Location: 1004206..1037633
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  F1538_RS04935 (F1538_04945) - 1004206..1004637 (-) 432 WP_013526153.1 gp436 family protein -
  F1538_RS04940 (F1538_04950) - 1004647..1004982 (-) 336 WP_013526154.1 hypothetical protein -
  F1538_RS04945 (F1538_04955) - 1005018..1005938 (-) 921 WP_013526155.1 Mu-like prophage major head subunit gpT family protein -
  F1538_RS04950 (F1538_04960) - 1005938..1006873 (-) 936 WP_232501049.1 phage protease -
  F1538_RS04955 (F1538_04965) - 1006815..1007168 (-) 354 WP_013526157.1 phage virion morphogenesis protein -
  F1538_RS04960 (F1538_04970) - 1007311..1008627 (-) 1317 WP_013526158.1 phage minor head protein -
  F1538_RS04965 (F1538_04975) - 1008611..1010232 (-) 1622 Protein_967 DUF935 domain-containing protein -
  F1538_RS04970 (F1538_04980) terL 1010312..1011961 (-) 1650 WP_013526159.1 phage terminase large subunit -
  F1538_RS04975 (F1538_04985) - 1012111..1012611 (-) 501 WP_013526160.1 DUF1804 family protein -
  F1538_RS04980 (F1538_04990) - 1012613..1012879 (-) 267 WP_005661915.1 hypothetical protein -
  F1538_RS04985 (F1538_04995) - 1012879..1013136 (-) 258 WP_005684166.1 hypothetical protein -
  F1538_RS04990 (F1538_05000) - 1013260..1013517 (-) 258 WP_013526161.1 DUF2681 domain-containing protein -
  F1538_RS04995 (F1538_05005) - 1013517..1013807 (-) 291 WP_041174960.1 DUF2644 domain-containing protein -
  F1538_RS10170 - 1013804..1013971 (-) 168 WP_171034543.1 hypothetical protein -
  F1538_RS05000 (F1538_05010) - 1013961..1014464 (-) 504 WP_013526163.1 glycoside hydrolase family 108 protein -
  F1538_RS05005 (F1538_05015) - 1014545..1014973 (-) 429 WP_013526164.1 Mor transcription activator family protein -
  F1538_RS05010 (F1538_05020) - 1015085..1015501 (-) 417 WP_013526165.1 type II toxin-antitoxin system HicB family antitoxin -
  F1538_RS05015 (F1538_05025) - 1015556..1015732 (-) 177 WP_041174961.1 type II toxin-antitoxin system HicA family toxin -
  F1538_RS05020 (F1538_05030) - 1015857..1016075 (-) 219 WP_005641522.1 hypothetical protein -
  F1538_RS05025 (F1538_05035) - 1016086..1016727 (-) 642 WP_013526166.1 antA/AntB antirepressor family protein -
  F1538_RS05030 (F1538_05040) - 1017264..1017467 (-) 204 WP_006996626.1 KilA-N domain-containing protein -
  F1538_RS05035 (F1538_05045) - 1017494..1017892 (-) 399 WP_013526167.1 gp16 family protein -
  F1538_RS05040 (F1538_05050) - 1018133..1018381 (-) 249 WP_006996624.1 hypothetical protein -
  F1538_RS05045 (F1538_05055) - 1018386..1018559 (-) 174 WP_006996623.1 hypothetical protein -
  F1538_RS10175 - 1018556..1018720 (-) 165 WP_171034544.1 hypothetical protein -
  F1538_RS05050 (F1538_05060) - 1018731..1018928 (-) 198 WP_006996621.1 ANR family transcriptional regulator -
  F1538_RS05055 (F1538_05065) - 1019115..1019732 (-) 618 WP_013526168.1 DUF3164 family protein -
  F1538_RS05060 (F1538_05070) - 1019733..1019924 (-) 192 WP_005647090.1 HTH domain-containing protein -
  F1538_RS05065 (F1538_05075) - 1019933..1020229 (-) 297 WP_013526169.1 hypothetical protein -
  F1538_RS05070 (F1538_05080) - 1020241..1021121 (-) 881 Protein_990 AAA family ATPase -
  F1538_RS05075 (F1538_05085) - 1021173..1021571 (-) 399 WP_032826358.1 hypothetical protein -
  F1538_RS05080 (F1538_05090) - 1021582..1023567 (-) 1986 WP_013526171.1 Mu transposase C-terminal domain-containing protein -
  F1538_RS05085 (F1538_05095) - 1023611..1023889 (-) 279 WP_041174962.1 helix-turn-helix domain-containing protein -
  F1538_RS05090 (F1538_05100) - 1024065..1024781 (+) 717 WP_013526172.1 S24 family peptidase -
  F1538_RS10180 - 1025162..1025329 (-) 168 WP_158305134.1 hypothetical protein -
  F1538_RS05095 (F1538_05105) rumB 1025374..1025808 (+) 435 Protein_996 23S rRNA (uracil(747)-C(5))-methyltransferase -
  F1538_RS05100 (F1538_05110) crp 1026173..1026847 (-) 675 WP_005647998.1 cAMP-activated global transcriptional regulator CRP Regulator
  F1538_RS05105 (F1538_05115) - 1026832..1027083 (-) 252 WP_005647999.1 YheU family protein -
  F1538_RS05110 (F1538_05120) slmA 1027105..1027761 (-) 657 WP_005648000.1 nucleoid occlusion factor SlmA -
  F1538_RS05115 (F1538_05125) dut 1027765..1028220 (-) 456 WP_005631431.1 dUTP diphosphatase -
  F1538_RS05120 (F1538_05130) coaBC 1028268..1029470 (-) 1203 WP_011272308.1 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC -
  F1538_RS05125 (F1538_05135) radC 1029633..1030298 (+) 666 WP_013526173.1 DNA repair protein RadC -
  F1538_RS05130 (F1538_05140) rpmB 1030512..1030748 (+) 237 WP_005542826.1 50S ribosomal protein L28 -
  F1538_RS05135 (F1538_05145) rpmG 1030760..1030930 (+) 171 WP_005613503.1 50S ribosomal protein L33 -
  F1538_RS05140 (F1538_05150) - 1031278..1032642 (+) 1365 WP_013526174.1 diaminobutyrate--2-oxoglutarate transaminase -
  F1538_RS05145 (F1538_05155) ddc 1032833..1034368 (+) 1536 WP_013526175.1 L-2,4-diaminobutyrate decarboxylase -
  F1538_RS05150 (F1538_05160) mutM 1034603..1035418 (+) 816 WP_013526176.1 DNA-formamidopyrimidine glycosylase -
  F1538_RS05155 (F1538_05165) degS 1035492..1036514 (-) 1023 WP_013526177.1 outer membrane-stress sensor serine endopeptidase DegS -
  F1538_RS05160 (F1538_05170) ribD 1036515..1037633 (-) 1119 WP_013526178.1 bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD -

Sequence


Protein


Download         Length: 224 a.a.        Molecular weight: 25151.85 Da        Isoelectric Point: 6.8375

>NTDB_id=385802 F1538_RS05100 WP_005647998.1 1026173..1026847(-) (crp) [Haemophilus influenzae biotype aegyptius strain HE15/F3028]
MSNELTEIDEVVTSSQEEATQRDPVLDWFLTHCHLHKYPAKSTLIHAGEDATTLYYVIKGSVMVSSKDDEGKEMILTYLG
AGQFFGEAGLFDEGSKRSAWVKTKTTCEIAEISYKKYRQLIQANPEILMFLTAQLARRLQNTSRQVTNLAFLDVAGRIAQ
TLMNLAKQPEAMTHPDGMQIKITRQEIGQMVGCSRETVGRIIKMLEDQNLIHAHGKTIVVYGAR

Nucleotide


Download         Length: 675 bp        

>NTDB_id=385802 F1538_RS05100 WP_005647998.1 1026173..1026847(-) (crp) [Haemophilus influenzae biotype aegyptius strain HE15/F3028]
ATGTCAAATGAATTAACCGAAATTGATGAAGTTGTAACCTCCTCTCAAGAAGAAGCAACTCAACGAGATCCCGTTTTAGA
TTGGTTTCTTACTCACTGCCATTTGCATAAATATCCTGCAAAATCAACTTTAATTCATGCTGGGGAAGATGCGACCACGC
TGTATTATGTAATTAAAGGTTCTGTAATGGTATCTTCAAAAGATGATGAAGGCAAAGAGATGATCCTCACTTACTTAGGA
GCAGGACAATTTTTTGGCGAAGCGGGATTATTTGATGAAGGTTCAAAACGATCAGCTTGGGTAAAAACAAAAACAACATG
TGAAATTGCTGAAATTTCCTATAAGAAATATCGCCAGTTGATTCAGGCAAACCCTGAAATCTTAATGTTTCTCACTGCAC
AATTGGCAAGACGTTTGCAAAATACATCACGTCAAGTCACGAATTTGGCATTTTTAGACGTCGCAGGTCGCATCGCTCAA
ACTTTAATGAACTTAGCTAAACAGCCTGAAGCAATGACGCATCCTGATGGTATGCAAATCAAAATTACACGCCAAGAAAT
AGGGCAAATGGTGGGTTGTTCACGAGAAACTGTGGGGCGCATTATTAAGATGTTGGAGGATCAGAATCTTATCCACGCTC
ATGGAAAAACAATCGTTGTATATGGCGCAAGATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q4QLV0

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  crp Haemophilus influenzae Rd KW20

100

100

1

  crp Vibrio cholerae strain A1552

75.49

91.071

0.687

  crp Acinetobacter baumannii D1279779

48.705

86.161

0.42


Multiple sequence alignment