Detailed information    

insolico Bioinformatically predicted

Overview


Name   crp   Type   Regulator
Locus tag   F1537_RS09330 Genome accession   NZ_CP043770
Coordinates   1822076..1822750 (+) Length   224 a.a.
NCBI ID   WP_005647998.1    Uniprot ID   Q4QLV0
Organism   Haemophilus influenzae biotype aegyptius strain HE7/F1946     
Function   promote expression of competence genes (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1816281..1844718 1822076..1822750 within 0


Gene organization within MGE regions


Location: 1816281..1844718
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  F1537_RS09290 (F1537_09300) - 1816281..1817645 (-) 1365 WP_013526174.1 diaminobutyrate--2-oxoglutarate transaminase -
  F1537_RS09295 (F1537_09305) rpmG 1817993..1818163 (-) 171 WP_005613503.1 50S ribosomal protein L33 -
  F1537_RS09300 (F1537_09310) rpmB 1818175..1818411 (-) 237 WP_005542826.1 50S ribosomal protein L28 -
  F1537_RS09305 (F1537_09315) radC 1818625..1819290 (-) 666 WP_013526173.1 DNA repair protein RadC -
  F1537_RS09310 (F1537_09320) coaBC 1819453..1820655 (+) 1203 WP_011272308.1 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC -
  F1537_RS09315 (F1537_09325) dut 1820703..1821158 (+) 456 WP_005631431.1 dUTP diphosphatase -
  F1537_RS09320 (F1537_09330) slmA 1821162..1821818 (+) 657 WP_005648000.1 nucleoid occlusion factor SlmA -
  F1537_RS09325 (F1537_09335) - 1821840..1822091 (+) 252 WP_005647999.1 YheU family protein -
  F1537_RS09330 (F1537_09340) crp 1822076..1822750 (+) 675 WP_005647998.1 cAMP-activated global transcriptional regulator CRP Regulator
  F1537_RS09335 (F1537_09345) rumB 1823115..1823549 (-) 435 Protein_1791 23S rRNA (uracil(747)-C(5))-methyltransferase -
  F1537_RS10245 - 1823594..1823761 (+) 168 WP_158305134.1 hypothetical protein -
  F1537_RS09340 (F1537_09350) - 1824142..1824858 (-) 717 WP_013526172.1 S24 family peptidase -
  F1537_RS09345 (F1537_09355) - 1825034..1825312 (+) 279 WP_041174962.1 helix-turn-helix domain-containing protein -
  F1537_RS09350 (F1537_09360) - 1825356..1827341 (+) 1986 WP_013526171.1 Mu transposase C-terminal domain-containing protein -
  F1537_RS09355 (F1537_09365) - 1827352..1827750 (+) 399 WP_032826358.1 hypothetical protein -
  F1537_RS09360 (F1537_09370) - 1827802..1828682 (+) 881 Protein_1797 AAA family ATPase -
  F1537_RS09365 (F1537_09375) - 1828694..1828990 (+) 297 WP_013526169.1 hypothetical protein -
  F1537_RS09370 (F1537_09380) - 1828999..1829190 (+) 192 WP_005647090.1 HTH domain-containing protein -
  F1537_RS09375 (F1537_09385) - 1829191..1829808 (+) 618 WP_013526168.1 DUF3164 family protein -
  F1537_RS09380 (F1537_09390) - 1829995..1830192 (+) 198 WP_006996621.1 ANR family transcriptional regulator -
  F1537_RS10250 - 1830203..1830367 (+) 165 WP_171034544.1 hypothetical protein -
  F1537_RS09385 (F1537_09395) - 1830364..1830537 (+) 174 WP_006996623.1 hypothetical protein -
  F1537_RS09390 (F1537_09400) - 1830542..1830790 (+) 249 WP_006996624.1 hypothetical protein -
  F1537_RS09395 (F1537_09405) - 1831031..1831429 (+) 399 WP_013526167.1 gp16 family protein -
  F1537_RS09400 (F1537_09410) - 1831456..1831659 (+) 204 WP_006996626.1 KilA-N domain-containing protein -
  F1537_RS09405 (F1537_09415) - 1832196..1832837 (+) 642 WP_013526166.1 antA/AntB antirepressor family protein -
  F1537_RS09410 (F1537_09420) - 1832848..1833066 (+) 219 WP_005641522.1 hypothetical protein -
  F1537_RS09415 (F1537_09425) - 1833192..1833368 (+) 177 WP_041174961.1 type II toxin-antitoxin system HicA family toxin -
  F1537_RS09420 (F1537_09430) - 1833423..1833839 (+) 417 WP_013526165.1 type II toxin-antitoxin system HicB family antitoxin -
  F1537_RS09425 (F1537_09435) - 1833951..1834379 (+) 429 WP_013526164.1 Mor transcription activator family protein -
  F1537_RS09430 (F1537_09440) - 1834460..1834963 (+) 504 WP_013526163.1 glycoside hydrolase family 108 protein -
  F1537_RS09435 (F1537_09445) - 1835117..1835407 (+) 291 WP_041174960.1 DUF2644 domain-containing protein -
  F1537_RS09440 (F1537_09450) - 1835407..1835664 (+) 258 WP_013526161.1 DUF2681 domain-containing protein -
  F1537_RS09445 (F1537_09455) - 1835788..1836045 (+) 258 WP_005684166.1 hypothetical protein -
  F1537_RS09450 (F1537_09460) - 1836045..1836311 (+) 267 WP_005661915.1 hypothetical protein -
  F1537_RS09455 (F1537_09465) - 1836313..1836813 (+) 501 WP_013526160.1 DUF1804 family protein -
  F1537_RS09460 (F1537_09470) terL 1836963..1838612 (+) 1650 WP_013526159.1 phage terminase large subunit -
  F1537_RS09465 (F1537_09475) - 1838767..1840313 (+) 1547 Protein_1819 DUF935 domain-containing protein -
  F1537_RS09470 (F1537_09480) - 1840297..1841613 (+) 1317 WP_013526158.1 phage minor head protein -
  F1537_RS09475 (F1537_09485) - 1841756..1842109 (+) 354 WP_013526157.1 phage virion morphogenesis protein -
  F1537_RS09480 (F1537_09490) - 1842051..1842986 (+) 936 WP_232501049.1 phage protease -
  F1537_RS09485 (F1537_09495) - 1842986..1843906 (+) 921 WP_013526155.1 Mu-like prophage major head subunit gpT family protein -
  F1537_RS09490 (F1537_09500) - 1843942..1844277 (+) 336 WP_013526154.1 hypothetical protein -
  F1537_RS09495 (F1537_09505) - 1844287..1844718 (+) 432 WP_013526153.1 gp436 family protein -

Sequence


Protein


Download         Length: 224 a.a.        Molecular weight: 25151.85 Da        Isoelectric Point: 6.8375

>NTDB_id=385793 F1537_RS09330 WP_005647998.1 1822076..1822750(+) (crp) [Haemophilus influenzae biotype aegyptius strain HE7/F1946]
MSNELTEIDEVVTSSQEEATQRDPVLDWFLTHCHLHKYPAKSTLIHAGEDATTLYYVIKGSVMVSSKDDEGKEMILTYLG
AGQFFGEAGLFDEGSKRSAWVKTKTTCEIAEISYKKYRQLIQANPEILMFLTAQLARRLQNTSRQVTNLAFLDVAGRIAQ
TLMNLAKQPEAMTHPDGMQIKITRQEIGQMVGCSRETVGRIIKMLEDQNLIHAHGKTIVVYGAR

Nucleotide


Download         Length: 675 bp        

>NTDB_id=385793 F1537_RS09330 WP_005647998.1 1822076..1822750(+) (crp) [Haemophilus influenzae biotype aegyptius strain HE7/F1946]
ATGTCAAATGAATTAACCGAAATTGATGAAGTTGTAACCTCCTCTCAAGAAGAAGCAACTCAACGAGATCCCGTTTTAGA
TTGGTTTCTTACTCACTGCCATTTGCATAAATATCCTGCAAAATCAACTTTAATTCATGCTGGGGAAGATGCGACCACGC
TGTATTATGTAATTAAAGGTTCTGTAATGGTATCTTCAAAAGATGATGAAGGCAAAGAGATGATCCTCACTTACTTAGGA
GCAGGACAATTTTTTGGCGAAGCGGGATTATTTGATGAAGGTTCAAAACGATCAGCTTGGGTAAAAACAAAAACAACATG
TGAAATTGCTGAAATTTCCTATAAGAAATATCGCCAGTTGATTCAGGCAAACCCTGAAATCTTAATGTTTCTCACTGCAC
AATTGGCAAGACGTTTGCAAAATACATCACGTCAAGTCACGAATTTGGCATTTTTAGACGTCGCAGGTCGCATCGCTCAA
ACTTTAATGAACTTAGCTAAACAGCCTGAAGCAATGACGCATCCTGATGGTATGCAAATCAAAATTACACGCCAAGAAAT
AGGGCAAATGGTGGGTTGTTCACGAGAAACTGTGGGGCGCATTATTAAGATGTTGGAGGATCAGAATCTTATCCACGCTC
ATGGAAAAACAATCGTTGTATATGGCGCAAGATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q4QLV0

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  crp Haemophilus influenzae Rd KW20

100

100

1

  crp Vibrio cholerae strain A1552

75.49

91.071

0.687

  crp Acinetobacter baumannii D1279779

48.705

86.161

0.42


Multiple sequence alignment