Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   BAMF_RS32480 Genome accession   NC_014551
Coordinates   2424594..2424908 (-) Length   104 a.a.
NCBI ID   WP_014470662.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens DSM 7 = ATCC 23350     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2419594..2429908
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAMF_RS32435 (BAMF_2363) sinI 2420278..2420451 (+) 174 WP_013352860.1 anti-repressor SinI Regulator
  BAMF_RS32440 (BAMF_2364) sinR 2420485..2420820 (+) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  BAMF_RS32445 (BAMF_2365) tasA 2420868..2421653 (-) 786 WP_013352862.1 biofilm matrix protein TasA -
  BAMF_RS32450 (BAMF_2366) sipW 2421718..2422302 (-) 585 WP_013352863.1 signal peptidase I SipW -
  BAMF_RS32455 (BAMF_2367) tapA 2422274..2422945 (-) 672 WP_013352864.1 amyloid fiber anchoring/assembly protein TapA -
  BAMF_RS32460 (BAMF_2368) - 2423203..2423532 (+) 330 WP_013352865.1 DUF3889 domain-containing protein -
  BAMF_RS32465 (BAMF_2369) - 2423573..2423752 (-) 180 WP_013352866.1 YqzE family protein -
  BAMF_RS32470 (BAMF_2370) comGG 2423806..2424183 (-) 378 WP_013352867.1 competence type IV pilus minor pilin ComGG Machinery gene
  BAMF_RS32475 (BAMF_2371) comGF 2424185..2424685 (-) 501 WP_013352868.1 competence type IV pilus minor pilin ComGF -
  BAMF_RS32480 comGE 2424594..2424908 (-) 315 WP_014470662.1 competence type IV pilus minor pilin ComGE Machinery gene
  BAMF_RS32485 (BAMF_2372) comGD 2424892..2425329 (-) 438 WP_013352869.1 competence type IV pilus minor pilin ComGD Machinery gene
  BAMF_RS32490 (BAMF_2373) comGC 2425319..2425585 (-) 267 WP_044051905.1 competence type IV pilus major pilin ComGC Machinery gene
  BAMF_RS32495 (BAMF_2374) comGB 2425632..2426669 (-) 1038 WP_013352871.1 competence type IV pilus assembly protein ComGB Machinery gene
  BAMF_RS32500 (BAMF_2375) comGA 2426656..2427726 (-) 1071 WP_013352872.1 competence type IV pilus ATPase ComGA Machinery gene
  BAMF_RS32505 (BAMF_2376) - 2427920..2428870 (-) 951 WP_013352873.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11934.89 Da        Isoelectric Point: 6.2120

>NTDB_id=38488 BAMF_RS32480 WP_014470662.1 2424594..2424908(-) (comGE) [Bacillus amyloliquefaciens DSM 7 = ATCC 23350]
MQNGNKGFSTIETLSAMAIWLFLMISIVPVWTGMLTDNLKIEEHQEVYQLLHKHISAYMMSGKKQPSPDVTWKEDGDYYK
VCAAVRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=38488 BAMF_RS32480 WP_014470662.1 2424594..2424908(-) (comGE) [Bacillus amyloliquefaciens DSM 7 = ATCC 23350]
ATGCAGAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCTATTTGGCTGTTCCTTATGATTTCTAT
CGTTCCGGTCTGGACGGGCATGCTGACAGACAATCTGAAAATAGAAGAACACCAGGAAGTGTACCAGCTTCTTCATAAAC
ATATCAGCGCATATATGATGTCCGGAAAAAAGCAGCCATCTCCCGATGTGACGTGGAAGGAGGATGGTGATTATTACAAA
GTCTGTGCAGCTGTCCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481

Multiple sequence alignment