Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   BAMF_RS32435 Genome accession   NC_014551
Coordinates   2420278..2420451 (+) Length   57 a.a.
NCBI ID   WP_013352860.1    Uniprot ID   A0A9P1JIA1
Organism   Bacillus amyloliquefaciens DSM 7 = ATCC 23350     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2415278..2425451
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAMF_RS32420 (BAMF_2360) gcvT 2416089..2417189 (-) 1101 WP_013352857.1 glycine cleavage system aminomethyltransferase GcvT -
  BAMF_RS32425 (BAMF_2361) - 2417613..2419283 (+) 1671 WP_014470658.1 DEAD/DEAH box helicase -
  BAMF_RS32430 (BAMF_2362) - 2419304..2420098 (+) 795 WP_013352859.1 YqhG family protein -
  BAMF_RS32435 (BAMF_2363) sinI 2420278..2420451 (+) 174 WP_013352860.1 anti-repressor SinI Regulator
  BAMF_RS32440 (BAMF_2364) sinR 2420485..2420820 (+) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  BAMF_RS32445 (BAMF_2365) tasA 2420868..2421653 (-) 786 WP_013352862.1 biofilm matrix protein TasA -
  BAMF_RS32450 (BAMF_2366) sipW 2421718..2422302 (-) 585 WP_013352863.1 signal peptidase I SipW -
  BAMF_RS32455 (BAMF_2367) tapA 2422274..2422945 (-) 672 WP_013352864.1 amyloid fiber anchoring/assembly protein TapA -
  BAMF_RS32460 (BAMF_2368) - 2423203..2423532 (+) 330 WP_013352865.1 DUF3889 domain-containing protein -
  BAMF_RS32465 (BAMF_2369) - 2423573..2423752 (-) 180 WP_013352866.1 YqzE family protein -
  BAMF_RS32470 (BAMF_2370) comGG 2423806..2424183 (-) 378 WP_013352867.1 competence type IV pilus minor pilin ComGG Machinery gene
  BAMF_RS32475 (BAMF_2371) comGF 2424185..2424685 (-) 501 WP_013352868.1 competence type IV pilus minor pilin ComGF -
  BAMF_RS32480 comGE 2424594..2424908 (-) 315 WP_014470662.1 competence type IV pilus minor pilin ComGE Machinery gene
  BAMF_RS32485 (BAMF_2372) comGD 2424892..2425329 (-) 438 WP_013352869.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6689.61 Da        Isoelectric Point: 9.8173

>NTDB_id=38485 BAMF_RS32435 WP_013352860.1 2420278..2420451(+) (sinI) [Bacillus amyloliquefaciens DSM 7 = ATCC 23350]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=38485 BAMF_RS32435 WP_013352860.1 2420278..2420451(+) (sinI) [Bacillus amyloliquefaciens DSM 7 = ATCC 23350]
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

68.421

100

0.684

Multiple sequence alignment