Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BAMF_RS32435 | Genome accession | NC_014551 |
| Coordinates | 2420278..2420451 (+) | Length | 57 a.a. |
| NCBI ID | WP_013352860.1 | Uniprot ID | A0A9P1JIA1 |
| Organism | Bacillus amyloliquefaciens DSM 7 = ATCC 23350 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2415278..2425451
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BAMF_RS32420 (BAMF_2360) | gcvT | 2416089..2417189 (-) | 1101 | WP_013352857.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| BAMF_RS32425 (BAMF_2361) | - | 2417613..2419283 (+) | 1671 | WP_014470658.1 | DEAD/DEAH box helicase | - |
| BAMF_RS32430 (BAMF_2362) | - | 2419304..2420098 (+) | 795 | WP_013352859.1 | YqhG family protein | - |
| BAMF_RS32435 (BAMF_2363) | sinI | 2420278..2420451 (+) | 174 | WP_013352860.1 | anti-repressor SinI | Regulator |
| BAMF_RS32440 (BAMF_2364) | sinR | 2420485..2420820 (+) | 336 | WP_014470659.1 | transcriptional regulator SinR | Regulator |
| BAMF_RS32445 (BAMF_2365) | tasA | 2420868..2421653 (-) | 786 | WP_013352862.1 | biofilm matrix protein TasA | - |
| BAMF_RS32450 (BAMF_2366) | sipW | 2421718..2422302 (-) | 585 | WP_013352863.1 | signal peptidase I SipW | - |
| BAMF_RS32455 (BAMF_2367) | tapA | 2422274..2422945 (-) | 672 | WP_013352864.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BAMF_RS32460 (BAMF_2368) | - | 2423203..2423532 (+) | 330 | WP_013352865.1 | DUF3889 domain-containing protein | - |
| BAMF_RS32465 (BAMF_2369) | - | 2423573..2423752 (-) | 180 | WP_013352866.1 | YqzE family protein | - |
| BAMF_RS32470 (BAMF_2370) | comGG | 2423806..2424183 (-) | 378 | WP_013352867.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| BAMF_RS32475 (BAMF_2371) | comGF | 2424185..2424685 (-) | 501 | WP_013352868.1 | competence type IV pilus minor pilin ComGF | - |
| BAMF_RS32480 | comGE | 2424594..2424908 (-) | 315 | WP_014470662.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| BAMF_RS32485 (BAMF_2372) | comGD | 2424892..2425329 (-) | 438 | WP_013352869.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6689.61 Da Isoelectric Point: 9.8173
>NTDB_id=38485 BAMF_RS32435 WP_013352860.1 2420278..2420451(+) (sinI) [Bacillus amyloliquefaciens DSM 7 = ATCC 23350]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=38485 BAMF_RS32435 WP_013352860.1 2420278..2420451(+) (sinI) [Bacillus amyloliquefaciens DSM 7 = ATCC 23350]
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
68.421 |
100 |
0.684 |