Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HG563_RS00200 Genome accession   NZ_CP051504
Coordinates   35532..35645 (+) Length   37 a.a.
NCBI ID   WP_001218100.1    Uniprot ID   -
Organism   Helicobacter pylori strain SHIM-011     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 30532..40645
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HG563_RS00175 (HG563_00175) - 30571..32793 (+) 2223 WP_001051542.1 ATP-dependent Clp protease ATP-binding subunit -
  HG563_RS00180 (HG563_00180) panD 32783..33133 (+) 351 WP_000142296.1 aspartate 1-decarboxylase -
  HG563_RS00185 (HG563_00185) - 33144..33446 (+) 303 WP_000347918.1 YbaB/EbfC family nucleoid-associated protein -
  HG563_RS00190 (HG563_00190) - 33446..34453 (+) 1008 WP_000468454.1 PDZ domain-containing protein -
  HG563_RS00195 (HG563_00195) comB6 34461..35516 (+) 1056 WP_202273666.1 P-type conjugative transfer protein TrbL Machinery gene
  HG563_RS00200 (HG563_00200) comB7 35532..35645 (+) 114 WP_001218100.1 hypothetical protein Machinery gene
  HG563_RS00205 (HG563_00205) comB8 35642..36385 (+) 744 WP_000660502.1 virB8 family protein Machinery gene
  HG563_RS00210 (HG563_00210) comB9 36385..37341 (+) 957 WP_014662053.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HG563_RS00215 (HG563_00215) comB10 37334..38470 (+) 1137 WP_202273431.1 DNA type IV secretion system protein ComB10 Machinery gene
  HG563_RS00220 (HG563_00220) - 38541..39953 (+) 1413 WP_000694833.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4263.19 Da        Isoelectric Point: 9.3572

>NTDB_id=384844 HG563_RS00200 WP_001218100.1 35532..35645(+) (comB7) [Helicobacter pylori strain SHIM-011]
MRIFSVIMGIMLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=384844 HG563_RS00200 WP_001218100.1 35532..35645(+) (comB7) [Helicobacter pylori strain SHIM-011]
ATGAGAATTTTTTCTGTCATTATGGGAATCATGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

89.189

100

0.892


Multiple sequence alignment