Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HP2018_RS00200 Genome accession   NC_017381
Coordinates   37545..37658 (+) Length   37 a.a.
NCBI ID   WP_001217877.1    Uniprot ID   -
Organism   Helicobacter pylori 2018     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 32545..42658
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HP2018_RS00175 (hp2018_0037) - 32586..34814 (+) 2229 WP_000357218.1 AAA family ATPase -
  HP2018_RS00180 (hp2018_0038) panD 34804..35157 (+) 354 WP_000142275.1 aspartate 1-decarboxylase -
  HP2018_RS00185 (hp2018_0039) - 35160..35462 (+) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  HP2018_RS00190 (hp2018_0040) - 35462..36466 (+) 1005 WP_000965841.1 PDZ domain-containing protein -
  HP2018_RS00195 (hp2018_0041) comB6 36474..37529 (+) 1056 WP_000679715.1 P-type conjugative transfer protein TrbL Machinery gene
  HP2018_RS00200 (hp2018_0042) comB7 37545..37658 (+) 114 WP_001217877.1 hypothetical protein Machinery gene
  HP2018_RS00205 (hp2018_0043) comB8 37655..38398 (+) 744 WP_000660538.1 type IV secretion system protein Machinery gene
  HP2018_RS00210 (hp2018_0044) comB9 38398..39384 (+) 987 WP_014536255.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HP2018_RS00215 (hp2018_0045) comB10 39377..40507 (+) 1131 WP_001045760.1 DNA type IV secretion system protein ComB10 Machinery gene
  HP2018_RS00220 (hp2018_0046) - 40577..41989 (+) 1413 WP_000694991.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4291.23 Da        Isoelectric Point: 9.3572

>NTDB_id=38226 HP2018_RS00200 WP_001217877.1 37545..37658(+) (comB7) [Helicobacter pylori 2018]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=38226 HP2018_RS00200 WP_001217877.1 37545..37658(+) (comB7) [Helicobacter pylori 2018]
ATGAGGATTTTTTTTGTTATTATGGGACTTGTGCTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAGAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

97.297

100

0.973


Multiple sequence alignment